KEGG   Melaminivora sp. SC2-7: C7H73_12195Help
Entry
C7H73_12195       CDS       T05362                                 

Definition
(GenBank) copper ABC transporter ATP-binding protein
  KO
K19340  Cu-processing system ATP-binding protein
Organism
melm  Melaminivora sp. SC2-7
Pathway
melm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:melm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C7H73_12195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:melm02000]
    C7H73_12195
Transporters [BR:melm02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Copper-processing transporter
    C7H73_12195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_29 AAA_15 AAA_23 AAA_30 MMR_HSR1 RsgA_GTPase SbcCD_C
Motif
Other DBs
NCBI-ProteinID: AVP58348
UniProt: A0A2P1NMQ0
LinkDB All DBs
Position
2666736..2667668
Genome map
AA seq 310 aa AA seqDB search
MASTFPANEPLAIHLRGVSKHWGALHAVDGVDLDVPAGEIFGLIGHNGAGKSTLFKMMLG
LLAPTAGDIRVAGASITGRGARAARRQLGYLPENVVLYDNLDGLETLRFFARLKGAPLVQ
CPQMLERVGLAHAGKRPVREYSKGMRQRLGFAQALLGSPRVLFLDEPTNGLDPQAIRDFY
ATLRELQSGGVTVIITSHILAELQERVDRLAILAAGRLQAVGSVQELRERTQMPLTVELE
IAEGDRAGAVAALAQATGVQSEPTDTGLRLQCAREHKMAVLAAVSALGARVHDMKLIEPS
LEDVFFGFSA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagcactttcccggccaatgaacccctggccatccacctgcgcggcgtcagcaag
cactggggcgcgctgcacgccgtggacggcgtggatctcgacgtccccgcgggtgagatc
ttcggcctgatcggccacaacggcgcgggcaagagcaccctgttcaagatgatgctgggc
ctgctggcgcccacggccggcgacatccgcgtggccggcgcctccatcaccgggcggggc
gcgcgcgccgcgcgccgccagctgggctatctgcccgagaacgtggtgctgtacgacaac
ctggatgggctggagacgctgcgcttcttcgcccgcctgaagggcgcgccgctggtccag
tgcccgcagatgctggaacgcgtgggcctggcccacgccggcaagcgcccggtgcgcgaa
tactccaagggcatgcgccagcgcctgggcttcgcgcaggcgctgctgggcagcccgcgc
gtgctgttcctggacgagccgaccaacggcctggacccgcaggccatccgcgacttctac
gccacgctgcgcgagctgcagtcgggcggcgtcaccgtcatcatcacctcgcacatcctg
gccgagctgcaggagcgcgtggaccgcctggccatcctggctgccggccgcctgcaggcc
gtgggcagcgtgcaggagctgcgcgagcgcacgcagatgccgctgaccgtggagctggaa
atcgccgaaggcgaccgcgccggcgcggtcgccgcgctggcgcaggccacgggcgtgcag
tccgagcccaccgacaccggcctgcgcctgcagtgcgcgcgcgaacacaagatggcggtg
ctggccgctgtgagcgccctgggcgcacgcgtgcacgacatgaaactcatcgaaccttcg
ctggaagacgtgttcttcggcttctctgcgtaa

DBGET integrated database retrieval system