KEGG   Pulveribacter suum: C7H73_12460Help
Entry
C7H73_12460       CDS       T05362                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
melm  Pulveribacter suum
Brite
KEGG Orthology (KO) [BR:melm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7H73_12460
Enzymes [BR:melm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7H73_12460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO AlaDh_PNT_C Glutaredoxin FAD_binding_3 NAD_binding_7 Thi4 K_oxygenase NAD_binding_9 NAD_binding_8 FMO-like DSBA
Motif
Other DBs
NCBI-ProteinID: AVP58399
UniProt: A0A2P1NMW8
LinkDB All DBs
Position
complement(2729109..2730677)
Genome map
AA seq 522 aa AA seqDB search
MLDANLQAQLKAYLERLQRPVELVATLDDSATAHELRELLKQIASLSDKVTVVEAGDMPV
RKPSFLITNPGVDTGVRFAGVPLGHEFTSLVLALLQVGGHPSKEAADLLEQVRNLPGEHH
FETYYSLSCHNCPDVVQALNLMSVLNPGITHTAIDGGVFQQEVKDRQVMGVPTVFLNGEH
FGQGRMELAEIIGKLDSGAAGRDAEKLAAKEAFDVLIVGGGPAGAAAAIYAARKGIRTGV
ASERFGGQVLDTVDIENYISIQKTEGPQFAAALERHVRDYEVDIMNLQAAKALKPAAEEG
GLIEVELENGATLRSRTVILATGARWRSMGVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGVVAHVTVLEFAPELKADAVLQRKLRSMPNVDIILNAQTTEVTGD
GSRVNGLSYKDRTSDEVKHVALEGIFVQIGLLPNTDWLKGTVELSKFGEIVVDARNHTNV
SGVFAAGDCTTVPYKQIVIAAGEGSKAALSAFDHLIRTTAPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgccaacctccaagcccaactgaaagcctacctggagcgcctgcagcgcccc
gtggaactggtggccacgctggacgacagcgccaccgcgcacgagctgcgcgagctcctg
aaacagatcgcgtccctgtcggacaaggtcaccgtggtggaggcgggcgacatgcccgtg
cgcaagccctcgttcctcatcaccaacccgggcgtggacaccggcgtgcgctttgccggc
gtgccgctgggccatgagttcacctcgctggtgctggcgctgctgcaggtcggcggccac
ccgagcaaggaagccgccgacctgctggaacaggtcagaaacctgcctggcgagcaccac
ttcgagacgtactactcgctgtcgtgccacaactgcccggacgtggtgcaggcgctcaac
ctgatgagcgtgctcaaccccggcatcacgcacaccgccatcgacggcggcgtgttccag
caggaggtcaaggaccgccaggtcatgggcgtgcccaccgtgttcctgaatggcgagcac
tttggccagggccgcatggagctggccgagatcatcggcaagctcgactctggagcggcg
gggcgcgacgcggaaaagctcgccgccaaggaggcgtttgacgtgctgatcgtcggcggc
ggcccggccggcgcggcggccgccatctacgctgcacgcaagggcatccgcaccggggtg
gcgtccgagcgcttcggcggccaggtgctcgataccgtggacatcgagaactacatctcc
atccaaaagaccgaggggccgcagttcgccgccgcgctggagcgccacgtgcgcgactac
gaggtggacatcatgaacctgcaggccgcgaaggccctgaagcccgctgccgaagaaggc
ggcctgatcgaggtcgaactggagaacggcgccacgttgcgcagccgcaccgtcatcctg
gccacgggcgcgcgctggcgcagcatgggcgtgcccggcgaagagcagtaccgcaccaag
ggcgtgacgtattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtg
atcggtggcggcaactccggcatcgaggcggccatcgacctggccggcgtggtggcgcac
gtgacggtgctggagttcgcccccgagctcaaggccgacgccgtgctgcagcgcaagctg
cgcagcatgcccaacgtggacatcatcctgaacgcccagaccaccgaggtgaccggcgac
ggcagccgggtgaacggcctgagctacaaggaccgcaccagcgatgaagtcaaacacgtg
gcgctggagggcatcttcgtgcagatcggcctgctgcccaacaccgactggctcaagggc
acggtggagctgagcaagtttggcgagatcgtggtggatgcgcgcaaccacaccaacgtc
tccggagtgttcgccgcgggcgactgcaccacggtgccgtacaagcagatcgtgatcgcc
gccggcgaaggctccaaggccgcgttgtccgcctttgaccacctgatccgcaccacggcg
ccggcttga

DBGET integrated database retrieval system