KEGG   Melaminivora sp. SC2-7: C7H73_13990Help
Entry
C7H73_13990       CDS       T05362                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
melm  Melaminivora sp. SC2-7
Pathway
melm00340  Histidine metabolism
melm01100  Metabolic pathways
melm01110  Biosynthesis of secondary metabolites
melm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:melm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    C7H73_13990
Enzymes [BR:melm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     C7H73_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH eRF1_2
Motif
Other DBs
NCBI-ProteinID: AVP58665
UniProt: A0A2P1NNN6
LinkDB All DBs
Position
complement(3055384..3055776)
Genome map
AA seq 130 aa AA seqDB search
MSSTSNDSLARLAAIIERRKPANGGDAQASYVARLLHKGPDAFLKKIGEEATEVVMAAKD
VQHGAAPAALVYEVADLWFHSMVALAYFGLAPADVIAELERREGTSGIEEKALRKAHARE
QEEAPGESTP
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccagcaacgattccctggcccgcctggccgccatcatcgaacgccgcaaa
cccgccaacggcggcgacgcgcaggccagctacgtggcgcggctgctgcacaaggggccg
gacgccttcctgaagaagatcggcgaggaggccaccgaagtggtcatggccgccaaggac
gtgcagcacggcgcggcgccggccgcgctggtctatgaggtggccgacctgtggtttcac
agcatggtggcgctggcctacttcggtctggcaccggccgacgtgatcgccgagctggag
cgccgcgaaggcaccagcggcatcgaggaaaaggccctgcgcaaggcacatgcgcgcgag
caggaagaagcaccaggagaaagcacgccatga

DBGET integrated database retrieval system