KEGG   Methanoculleus marisnigri: Memar_0169Help
Entry
Memar_0169        CDS       T00477                                 

Definition
(GenBank) glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mem  Methanoculleus marisnigri
Brite
KEGG Orthology (KO) [BR:mem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Memar_0169
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Memar_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox FAD_binding_2 Thi4 HI0933_like DAO NAD_binding_8 NAD_binding_7 GIDA GST_N_3 FAD_oxidored FAD_binding_3 Lycopene_cycl NAD_binding_9 Trp_halogenase Thioredoxin_3 Thioredoxin_2 GST_N_2 DUF836
Motif
Other DBs
NCBI-ProteinID: ABN56104
UniProt: A3CRV4
LinkDB All DBs
Position
154303..155511
Genome map
AA seq 402 aa AA seqDB search
MLNTVPEIFPFMAGVKVYTTENCPYCRMVKAFLRKHDIEHEIVDVGKDREAAREMIEISG
QRGVPVTVSGDEVVVGFDAKRLRELFGTALEETVYDAVIVGAGPAGLTAAVYCARKLMKT
VVIAENIGGQAAWSWAIENYMGFSTISGEELVRKFEEQVRGFDVRLELESVGDVRKEDDT
ILVRTASGTVYRSRTLILAPGKEPRRLGLPGEDRLMGKGISVCAICDAPLYRDKPVAVVG
GGNAALQTAIEMTKFASSVTLIARRDLRCDEVYVDRAKKAGVRTFSHHEVTALHGDAGLT
GVTVRDRETGEETGLDVEGLFLAIGLAPNTGFLKDLVVLNEQGEIDIDENGHTSVPGVFA
AGDATCVKAKQIIVAAGDGAKAALEAHEYFEGEPEEEQIVCT
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatactgtccccgagatattccccttcatggcaggcgttaaggtctacacgacg
gagaactgcccctactgccggatggtcaaggcgttcctccggaagcacgatatcgaacac
gagatcgtcgacgtcgggaaagaccgcgaggcggcccgggagatgatcgagatctcgggg
caacggggtgtgccggtcacggtatccggcgacgaggtggtcgtcgggttcgatgcaaag
aggctccgggagctcttcgggacggcgctggaggagaccgtctacgacgcggtcatcgtg
ggcgctggtccggcagggctgacggcggcggtctactgcgcccggaaactcatgaagacc
gtcgtcatagcggagaacatcggtgggcaggcggcctggagctgggctatcgagaactac
atggggttctcgacgatatcgggcgaggaactggtccggaagttcgaggagcaggtccgg
gggttcgacgtccgtctcgagctcgagagcgtcggggacgttcgcaaagaggacgatacg
atcctcgtccggacggcctcggggaccgtctaccgttcccggacgctcatcctcgctccc
gggaaggagccccggcggctggggcttcccggtgaggaccggctgatgggaaagggtatc
tcggtctgcgctatctgcgacgccccgctctaccgcgataaaccggttgccgtcgtcggc
ggcggaaacgccgccctccagaccgcgatcgagatgacgaagttcgcgagttcggtgacc
ctgatcgcccggagggatctccggtgcgacgaggtctacgtcgaccgggcaaagaaggcg
ggggtgcggactttctcccaccacgaggtgacggcgctccacggggacgcgggcctgacc
ggggtcacggtccgcgaccgcgagaccggggaggagacgggtctcgatgtggaggggctc
ttcctcgcgatcgggcttgcgccgaatacgggcttcctcaaggatctcgtggtgctgaac
gagcagggcgagatcgatatcgacgaaaatggccatacgagcgttcccggggtcttcgcg
gccggggacgcgacctgcgtcaaggccaagcagatcatcgtcgccgccggcgacggggcg
aaggcggcgctcgaggcgcacgagtatttcgaaggcgagccggaagaagagcagatcgtc
tgcacgtga

DBGET integrated database retrieval system