KEGG   Methanoculleus marisnigri: Memar_0339Help
Entry
Memar_0339        CDS       T00477                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00030  Pentose phosphate pathway
mem01100  Metabolic pathways
mem01120  Microbial metabolism in diverse environments
mem01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Memar_0339
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Memar_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABN56272
UniProt: A3CSC2
LinkDB All DBs
Position
318356..320155
Genome map
AA seq 599 aa AA seqDB search
MNGYAGKILHVDLAREQTMEEPFPEEWKRAYIGGRGLGVRIIGDLVNPGSDPLGAENVLV
FATGPVAGSGLPLGSRYDVVTKSPLTGTLTSANSGGKFGTSMKRAGYDAVVIRGRAQRPV
YLLLDDGHAEVRDASELWGLTTSETTSAIQNDLNDPGASVACIGPAGERLVRIAGVINET
SRAAGRGGVGAAMGSKNLKALAARGSGRCTVADRDRFLALKSDIAEKIRENAISGGGLPR
FGTAVLVNIINENYILPVRNFQIAHFPAAENVSGERMADTILTGKMGCQGCVIQCGRDVE
VEGKRTAGPEYETIWAFGPDCGIDDLAAVVKANNLCNDLGLDTISTGSTIACAMELSEKG
YIDEEVRFGDAEQMLDLVHRIGYRDGIGDELAEGSFRFARRHGHPELSMSVKRQELPAYD
PRGLQGHGLAYATSVRGGDHVYAYLIAPEVLGSPEKLDPYSSEGKAVWTKTFQDLTAFID
SSGSCLFTSFPLGAADYGAMVSAVTGYDIDAGEVLRIGERIWNLQKVFNIRAGCTREDDT
LPPRLLREPLTEGAPKGRVWEREPLLDEYYRVRGWDREGRPTPEKLRDLGIGEEAVAAP
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctatgcaggaaagatcctccacgtcgacctcgcgagagaacagacgatggag
gagccgtttcccgaagagtggaagcgggcgtacatcggcgggagggggctcggggttcgc
atcataggcgacctggtgaacccgggcagcgatcctctcggcgctgagaacgtgctggtc
ttcgccaccgggccggttgcggggagcggcctcccgctgggatcccggtacgacgtcgtc
acgaagtcgccgctgaccgggacactgaccagcgccaactccggcgggaagttcggcacc
agcatgaaacgtgcgggctacgatgcggtggtgatccgggggcgggcacagagacccgtc
tacctcctcctcgacgacgggcacgcggaggtccgggatgcttcagaactgtgggggctg
acgacgagcgagacaacctctgctatccagaacgatctcaacgacccgggcgcgagcgtg
gcctgcatcggccccgccggcgagcgcctcgtccggatcgccggcgtcatcaacgagacc
tcgcgggccgcagggcgcgggggtgtcggtgccgcgatgggctcgaagaacctcaaagcc
ctcgccgcccgggggagcggccggtgcaccgtcgccgatcgcgaccggttcctcgccctt
aaatcagatatcgccgagaagatccgggagaatgccatctcgggcggcgggctgccccgg
ttcgggacggcggtcctcgtgaacatcatcaacgagaactacatcctcccggtccggaac
ttccagatcgcacacttccccgcagcggagaacgtctcgggggagcggatggccgatacc
atcctcaccggaaagatgggatgccagggctgcgtcatccagtgcggccgcgacgtcgag
gtcgaagggaagcggacggcaggccccgagtacgagacgatctgggcgttcggccccgac
tgcgggatcgatgaccttgcggccgttgtgaaggcgaacaatctctgcaacgacctcggt
ctcgatacgatctccaccggatcgacgatcgcctgcgccatggaactctcggagaagggc
tacatcgacgaagaggtccggttcggcgacgcagagcagatgctcgacctcgtccaccgg
atcggctaccgcgacggcatcggcgacgaactcgccgaaggatccttccgcttcgcaagg
aggcacgggcacccggaactctccatgagcgtcaaacggcaggaactccctgcttacgac
ccgcgggggctgcaggggcacggtcttgcctacgccacctcggtccggggcggcgatcat
gtctacgcctacctgatcgcccccgaagtgctcgggtcgccggagaaactcgacccctac
tcgagtgagggaaaagccgtctggacgaagacgttccaggacctcaccgccttcatcgac
tcatcgggaagctgtctcttcacctcgttcccgctcggggcggcagactacggcgcgatg
gtctcggcggtcaccggctacgatatcgatgccggcgaggtgctccggatcggcgagcgg
atctggaacctgcagaaggtcttcaacataagagccgggtgcacccgggaggacgacacc
ctgccgccgcgtctcctccgggagccgcttaccgaaggcgccccgaaaggccgggtctgg
gagcgggagcctcttctcgacgagtactaccgggtccggggatgggaccgggaaggccgt
cccacgccggagaaactccgcgacctcgggatcggcgaggaggcggtggccgcgccgtga

DBGET integrated database retrieval system