KEGG   Methanoculleus marisnigri: Memar_0875Help
Entry
Memar_0875        CDS       T00477                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00380  Tryptophan metabolism
mem00630  Glyoxylate and dicarboxylate metabolism
mem01110  Biosynthesis of secondary metabolites
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Memar_0875
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Memar_0875
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Memar_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI MctB
Motif
Other DBs
NCBI-ProteinID: ABN56808
UniProt: A3CTV8
LinkDB All DBs
Position
complement(853504..855627)
Genome map
AA seq 707 aa AA seqDB search
MDQKRKVDEKSKQEQLDEFRQDPEQEYLTTNQAVRVSHTDDSLKAGERGPTLLEDFHFRE
KLTHFDHERIPERVVHARGSGAHGYFQVYEPMTEYTRAAFLQDPAKKTPVFVRFSTVVGF
RGSADTVRDVRGFATKFYTEEGNYDLVGNNMPVFFIVDAIKFPDLVHAIKPEQHHQMPQA
SAAHDTFWDFVGNLPEITHMIMWVLSDRALPRSYRMMEGFGVNTFRFINAEGKARFIKFH
WRPQLGVHSLVWDETQKIAGKDPDFNRRDLWEAIEMGDYPEFELGVQMIEEADEHNFEFD
ILDATKLWPEEEVPIRWIGKMILNRNPDNFFAETEQVAFCPANVVPGIDFSNDPLLQGRL
FSYLDTQLIRLGGPNFQEIPINRTLAPAANNQREGYNRMTIDKGVVSYFPNALGENKPRP
ARVEEGGYAHYQEKIEGRKIRARSEKFNDHFSQAKLFWNSMSDAEKEHIVKAFHFELGKV
SDSGVRKRVVDLINNVDGDLAIRIAEGIGVPPPAEKGASSGTKKSPNLSQEKTVMDTIKS
RKVAILAMEGYDHDEVMQVKKALKDAGAHPQIVSQFRGMVKSADGKEMEVDKSYVTTTSV
VYDAVYVPGGRHAETLKNQGFAIHFVNEAFKHCKPIGAMGEGIELLKASDIKGVTFVDAG
TGGEAVSEMGVVTCGSQGDVNSFVEQFKTAIARHRHWDREKKEQVPA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaagagaaaggtagatgagaagagcaagcaggagcagctcgacgaattccgc
caggacccggagcaggagtacctgacgacgaaccaggcggtccgggtaagccataccgac
gactcgttaaaagcgggggagcgggggccgacgctccttgaggatttccacttccgcgag
aaactgacgcatttcgaccacgagcggatccccgagcgggtcgtccacgccaggggttcg
ggcgctcacggctactttcaggtctacgaaccgatgaccgagtatacgagggcggcgttc
ctccaggaccctgcaaagaaaacgccggtcttcgtccggttctcgacggtcgtcgggttc
cgcgggtctgccgatacggtcagggatgtccggggatttgcgacgaagttctacacggag
gaggggaattacgacctcgtcggcaacaacatgccggtcttcttcatcgtggacgccatc
aagttccccgacctcgttcacgccatcaaaccggagcagcatcaccagatgccgcaggcc
tccgccgcccacgacaccttctgggactttgtcgggaacctgcccgagatcacgcacatg
atcatgtgggttctctctgaccgtgcgctcccgaggagttaccggatgatggaggggttc
ggggtcaacaccttccggttcatcaacgccgaggggaaggcgcggttcatcaagttccac
tggcgaccgcagctcggggttcactcgctcgtctgggacgagacgcagaagatcgccggg
aaagacccggacttcaaccgccgcgacctctgggaggcgatcgagatgggagactacccg
gagttcgagctcggggtgcagatgatcgaggaggcggacgagcacaacttcgagttcgat
attctggacgcgacgaaactctggcccgaggaggaggtgccgatccggtggatcgggaag
atgattctgaaccggaacccggacaacttcttcgccgagaccgagcaggtcgctttctgc
ccggcgaacgtcgtgccggggatcgacttctcgaacgacccgctcctccagggccggctc
ttctcgtacctggatacccagctgatacgcctcggcggcccgaacttccaggagatcccg
atcaaccggacgctcgcgcccgccgcgaacaaccagcgggagggctacaaccggatgacg
atcgataagggtgtcgtgagttacttcccgaatgcgctcggcgagaacaaaccccggccg
gcccgggtggaggagggcggctacgcccactaccaggagaagatcgaggggaggaagatc
cgtgcacggagcgagaagttcaacgaccacttcagccaggcgaagctcttctggaacagc
atgtcggacgcggagaaggagcatatcgtcaaggccttccacttcgagctcgggaaggtc
tcggactccggggtccgcaaaagggtggtggacctcatcaacaacgtcgacggcgatctc
gcgatacggatcgcggaagggatcggggtgccgcccccggcggagaagggcgcatcctcc
ggcacgaagaagtccccgaacctcagccaggagaagaccgtcatggacaccatcaagagc
cggaaggtcgcgatcctcgctatggagggctacgaccacgacgaggtgatgcaggtgaag
aaggcgctcaaggatgcgggcgctcacccgcagatcgtctcgcagttccgcggcatggtc
aagtctgccgatggtaaagagatggaggtggacaagagttacgtcaccaccacctccgtc
gtgtacgacgccgtgtatgtcccgggcgggaggcacgcggagaccctgaagaaccagggc
ttcgcgatccacttcgtcaacgaggccttcaagcactgcaaaccgatcggagcgatggga
gaagggatcgaactcctgaaggcatcggatatcaagggtgtgaccttcgtcgatgcagga
accggaggagaggccgtctccgagatgggggtcgtcacctgtgggagccagggggacgtg
aactcgtttgtcgagcagttcaagacggccatcgcccggcaccgccactgggaccgggag
aagaaggagcaggtgccggcctga

DBGET integrated database retrieval system