KEGG   Methanoculleus sp. MAB1: MMAB1_0129Help
Entry
MMAB1_0129        CDS       T04314                                 

Definition
(GenBank) Glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mema  Methanoculleus sp. MAB1
Brite
KEGG Orthology (KO) [BR:mema00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MMAB1_0129
Enzymes [BR:mema01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MMAB1_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin GIDA Pyr_redox FAD_binding_2 Thi4 FAD_oxidored HI0933_like K_oxygenase DAO NAD_binding_8 Lycopene_cycl NAD_binding_9 GST_N_3 FAD_binding_3 NAD_binding_7 Trp_halogenase Staph_opine_DH Thioredoxin_3 GST_N_2 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: CVK31346
UniProt: A0A0X3BGS7
LinkDB All DBs
Position
chrI:92816..93997
Genome map
AA seq 393 aa AA seqDB search
MAGVKVYTTENCPYCRMVIAFLEKYGVEYETVDVGRDREAAREMITVSGQRGVPVTIFGD
AVIVGFDAKRLRELFGKPVTDGVYDVVIVGAGPAGLTAAVYCARKLMKTVIISENIGGQA
TWSWAIENYMGFRMITGEDLIRKFEEQVRGLDVNLELDSVQSVQKEGDIFLVRTAPGNAY
RCRTVILTSGKHPRTLGLPDEDRLMGRGVSVCSTCDGPLFRARPVAVVGGGNAAVQTAVE
LAKIASSVALVVRSTLKCDEIYIARAKEVGVQIFPHSEVSALHGEATLTGITVRDRETGK
ETVLNVEGLFLEIGLVPNTGFLKDLVALNNLGEIIVDENNHTSVPGVFAAGDATCIRGKQ
IIIAAGEGAKAALAAHEYLLKEDLSRAPTPAAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgtgaaggtctacacgacagagaactgcccctactgccggatggtcattgcg
ttccttgagaagtacggggtcgaatacgagaccgtcgatgtcgggagagaccgcgaggcg
gcccgggagatgataacggtctcggggcagcggggcgtgccggtcacgatctttggcgat
gcggtgatcgtcgggttcgacgcgaagcggctccgggaactcttcgggaagccggtgact
gacggggtctacgacgtggtcatcgtgggcgccgggccggccgggctgacggccgcggtc
tactgtgcgcgaaagctcatgaagaccgtcatcatatctgagaatatcggcggccaggcg
acctggagctgggcgatcgagaattatatgggctttcggatgatcacgggcgaggacctg
atcaggaagttcgaggagcaggtcagggggcttgacgtcaaccttgaactggatagcgtc
cagagtgtccagaaagagggcgatatcttccttgtccggacagcccccgggaacgcctac
cgctgccggacagtcatcctcacctccgggaagcacccccggaccctggggctccctgac
gaggaccggctgatggggaggggcgtctcggtctgctcgacctgtgacggcccgctcttc
cgcgcacgaccggtcgccgtcgtcggcggggggaacgcggcggtccagaccgcggtcgag
ctggcgaagatcgcgagttccgtggccctggtcgtcaggagcaccctcaagtgcgacgag
atctacatcgcccgggcaaaggaggtgggtgtgcagatattcccccacagcgaagtttcg
gcgctccacggcgaggcgaccctgaccgggatcacggtcagggaccgcgagaccgggaag
gagacggtcctcaacgttgaggggctcttcctcgagatcgggcttgtgccgaatacaggg
ttccttaaggatctggttgcgcttaataatctgggagagatcatcgtcgacgagaacaac
cacacgagtgtccccggggtctttgcggccggggatgcgacctgcatcaggggaaagcag
atcatcatcgccgccggcgagggggcgaaggctgcgcttgcggcgcacgagtacctcctg
aaggaggacctctcccgcgcccccacaccagcggccttatga

DBGET integrated database retrieval system