KEGG   Methanoculleus sp. MAB1: MMAB1_0810Help
Entry
MMAB1_0810        CDS       T04314                                 

Gene name
lig
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mema  Methanoculleus sp. MAB1
Pathway
mema03030  DNA replication
mema03410  Base excision repair
mema03420  Nucleotide excision repair
mema03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mema00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MMAB1_0810 (lig)
   03410 Base excision repair
    MMAB1_0810 (lig)
   03420 Nucleotide excision repair
    MMAB1_0810 (lig)
   03430 Mismatch repair
    MMAB1_0810 (lig)
Enzymes [BR:mema01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MMAB1_0810 (lig)
    6.5.1.6  DNA ligase (ATP or NAD+)
     MMAB1_0810 (lig)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MMAB1_0810 (lig)
DNA replication proteins [BR:mema03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MMAB1_0810 (lig)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MMAB1_0810 (lig)
DNA repair and recombination proteins [BR:mema03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MMAB1_0810 (lig)
   NER (nucleotide excision repair)
    Other NER factors
     MMAB1_0810 (lig)
   MMR (mismatch exicision repair)
    Other MMR factors
     MMAB1_0810 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: CVK32024
UniProt: A0A0X3BKG6
LinkDB All DBs
Position
chrI:652708..654456
Genome map
AA seq 582 aa AA seqDB search
MKFATLASCFERLNVTSSRNDMTALLARLLAGASPDEIGIVCYFTLGAIAPGYSGLTPGI
GERTAAAAIALAGSVDPAAVEAAARELGDYGDAAARLTVAPPEGSTGPLRVTDVHRGFME
IARASGPGSADRKTRVLAAMLAAATPPERRYLVRLATGEMRLGVGDMTLLDALAEAFLGS
KAERPPLEHAYNISSDVGLVARTLQESGLAGVSAIPVTLHHPIRPMLTQRVSRISEIPER
IGSRVIAVEEKYDGERVQAHKDGDDVTLFSRRLTDVTHQYPDIVRHIRRCVTADTAILDG
EAVAFDHETGTYRPFQTLMRRRRKHRVREVAGEIPATYRVFDLLYVNGESYLRRSYPDRR
ARLEEVLSPDEKISPADRTLTGDLDGITEFYLACIERGLEGVVCKSCAEDSFYRAGAREW
QWIKWKSDYGTELADTLDLVVVGANAGRGKRAGTYGSVLCAAYNHEEDIFQTVCGMGTGF
TDADLADLPRRFAGVRVDRQPARVMVTPQAVPDFWFAPARVVEVLGLEITESPVHTCNWD
PEWRRGLALRFPRFVRWRDEKSPEAATTTAEVAAMFRRRREG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattcgcaacccttgcctcctgctttgagaggctaaacgtcacatcgtcccggaac
gatatgaccgccctcctcgcgcggctcctcgccggggcgtctccggacgagatcggcatc
gtctgctacttcacgctcggggcgatcgcgccaggatacagcgggttgaccccgggcatc
ggggagcggaccgcagcggcggcgatcgcccttgcgggcagcgtcgaccctgcagcggtc
gaggcggcggcccgggaactcggcgactatggggacgccgccgcccgcctgaccgtggcg
cccccggagggatccaccggaccgctcagggtcacggacgtccaccgcggctttatggag
atcgcccgggcatcgggtcctggttcggccgaccggaagacgcgggttctcgccgcgatg
ctcgccgccgccacgcccccggagcggcgctacctggtcaggcttgccaccggggagatg
cggctcggcgtcggggatatgacgctcctcgatgcgctggcggaggcgttcctggggtcg
aaggcagagcgcccgcccctcgagcacgcctacaacatctcttcagacgtcggcctcgtg
gcccggacgctccaggaatcgggtctcgcgggggtctcggcgataccggtcaccctgcac
caccccatcaggccgatgctcacccagcgggtctcccggatatcagagatccctgagcgg
atcggctcccgggtcatcgccgtcgaggaaaagtacgacggtgagcgggtccaggcccac
aaagacggcgacgacgtcaccctcttctcacggcggctgactgatgtcacccaccagtat
cccgacatcgtccggcacatccggcggtgcgtcacggccgatacggcgatcctcgacggc
gaggcggtcgcgttcgaccacgagaccgggacctaccggcctttccagaccctgatgcgg
cggcgccggaagcaccgggtcagggaggtcgccggtgagatccccgcgacctaccgggtc
ttcgacctcctctacgtgaacggcgagtcatacctccgccggagttacccggaccggcgt
gcgaggctcgaagaggtcctctcccctgatgaaaagatatccccggcagaccgcaccctg
accggggatctcgacgggatcacggagttctaccttgcctgcatcgagcgggggcttgaa
ggggtcgtctgcaagtcgtgcgcggaggactcgttctaccgggcgggggcgcgggaatgg
cagtggatcaagtggaagagcgattacggaaccgaacttgccgacacgctcgacctggtc
gtcgtcggcgccaacgccgggcgcgggaagcgggccgggacctacggatcggtcctctgc
gccgcctacaaccatgaggaggatatcttccagacggtctgcggcatggggacggggttt
accgatgcagacctggcagacctcccccgacggttcgccggtgtccgggtggaccggcaa
cctgcccgggtgatggtgaccccacaggccgtgcctgacttctggttcgcaccggcccgg
gtggtcgaggtgctggggcttgagatcaccgaaagcccggtccatacctgcaactgggac
cccgagtggcggcgggggcttgccctcaggttcccaaggtttgtgcggtggcgggacgag
aagagcccggaagcggcaacgacgaccgccgaggtcgcggcgatgttccgcaggcggcgg
gaggggtag

DBGET integrated database retrieval system