KEGG   Methanoculleus sp. MAB1: MMAB1_1867Help
Entry
MMAB1_1867        CDS       T04314                                 

Gene name
ppcA
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mema  Methanoculleus sp. MAB1
Pathway
mema00620  Pyruvate metabolism
mema00680  Methane metabolism
mema00720  Carbon fixation pathways in prokaryotes
mema01100  Metabolic pathways
mema01120  Microbial metabolism in diverse environments
mema01200  Carbon metabolism
Module
mema_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMAB1_1867 (ppcA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMAB1_1867 (ppcA)
   00680 Methane metabolism
    MMAB1_1867 (ppcA)
Enzymes [BR:mema01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MMAB1_1867 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: CVK33080
UniProt: A0A0X3BMG0
LinkDB All DBs
Position
chrI:1492726..1494162
Genome map
AA seq 478 aa AA seqDB search
MSTQHPDNVNLPFFAESPELGGEDEVQEAYYAYSHLGCTEQMWDCEGKEVDNFVVRKLLS
RYDAFFREKRLGRDVFLTLRVPNPEVETAEAKILLETLESIPRSYDTACLFYGDECPPIF
EVILPMTASHTAIDNIYRYYTDIVVGKQERSLGEGGMTIADWIGRFRPDRINVIPLFEEM
DHMLDAHNAVRRYLEGKDITHQRVFLARSDPAMNYGIVSAVLLNKIALQHLQEVSEETGT
GIYPIIGVGSAPFRGGLSPRTVDQVTAEYPSVHTFTVQSAFKYDHPLEEVQNAVRRLEER
RPGRPRPVDEEAALDLIERYTRAYEQRLGPLAPLINRVARYVPERRKRKLHIGLFGYARS
TVGITLPRAIKFTAALYSVGFPPEILGLDALDDTDIGFVRETYVNFDENLKAAARYLNTE
TGLVPRELAARVADLVDIEPDEEHAEVTAEIARALRENDTGKLSALVLQAAHCRKFLG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccagcaccctgacaacgtcaacctgccgttctttgccgagagcccggaactc
ggcggtgaagacgaggtccaggaggcgtactacgcctattcccacctgggatgcaccgaa
cagatgtgggactgtgagggaaaagaggtcgacaacttcgtggtcaggaaactcctctcc
cggtacgatgcgttcttcagggagaagagactcggcagggacgtcttcctgacgctccgg
gttccaaaccccgaggtcgagacggccgaggcaaagatactcctcgagacgctcgagagc
atcccgcggtcgtatgatacggcgtgcctcttctacggggacgagtgtcccccgatattc
gaggtcattctcccgatgacggcgtcccacactgccatcgataatatctaccgctattat
accgatatcgtcgtcgggaagcaggagagaagtctcggtgagggcggcatgaccatcgca
gactggatcgggaggttccggccggaccggatcaacgtcatcccactctttgaagagatg
gaccatatgctggatgcgcacaacgcggtcaggcgctacctcgaagggaaggatatcacc
caccagcgcgtctttctcgcccggtcggacccggcgatgaactacgggatcgtcagcgcg
gtcctcctgaataagatcgcgctccagcacctccaggaggtctcggaggagacggggacg
gggatatacccgatcattggcgtgggttcggcgccgtttcggggcggcctctcaccccgg
accgtcgaccaggtcaccgccgaatacccgagcgtccacacgttcaccgtccagtctgcg
tttaagtatgaccacccgctcgaagaagtccagaacgcggttcggagactggaggagcgg
aggcccggccgaccccggcccgtcgacgaggaggcggcgctcgacctgattgagagatat
acacgggcatacgagcaacggctcgggccgcttgcccccctgatcaaccgggttgcccgc
tacgttcctgagcggcggaagcggaaactgcatatcggtctcttcgggtatgcccggagc
accgtcgggatcaccctgccgcgggcgatcaagttcaccgctgccctctactcggtcggg
ttcccgcctgagatcctcggcctggatgcgctggacgatacggatatcgggttcgtcagg
gagacctacgtcaacttcgacgagaacctgaaggccgctgcccgctacctaaatacggag
acggggctcgtcccccgggaacttgcggcccgggtggccgacctggtggatatcgagcct
gacgaggagcatgcggaggtcacggccgagatcgcccgggcgctccgcgagaacgatacc
gggaagttgagcgcccttgtcctgcaggcggcgcactgccggaagttcctggggtga

DBGET integrated database retrieval system