KEGG   Candidatus Moranella endobia PCIT: MEPCIT_037Help
Entry
MEPCIT_037        CDS       T01562                                 

Definition
(GenBank) putative enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
men00061  Fatty acid biosynthesis
men00780  Biotin metabolism
men01100  Metabolic pathways
men01130  Biosynthesis of antibiotics
men01212  Fatty acid metabolism
Module
men_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:men00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MEPCIT_037
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MEPCIT_037
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    MEPCIT_037
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:men01004]
    MEPCIT_037
Enzymes [BR:men01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     MEPCIT_037
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     MEPCIT_037
Lipid biosynthesis proteins [BR:men01004]
 Fatty acid synthase
  Component type
   MEPCIT_037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AEI74702
UniProt: F7XX76
LinkDB All DBs
Position
complement(41853..42641)
Genome map
AA seq 262 aa AA seqDB search
MGFLVGKRILVTGVANNRSIAYGIAQALHLQGAELAFTYQCDKFKSRVEGFAADFNSNIV
LPCDVTTDANIKALFKHLAKVWPTFSGFVHAIAYSPVNQLNGDYVNTVTREGFTITHNIS
AYSFVAMAKSSRCMLNSNSALLTLTYLGAERAIPNYNVMGLAKASLEANTRYMANAMGPQ
GVRVNAISAGPIRTLAASGIKQFKKMLHHYESVAPLRRVVTITDVGNTAAFLCSDLSAGI
TGEVIHVDNGFNIATMNDIAFD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttgttggtaagcgtattctagtgactggtgttgctaataatcgttcaatt
gcctatggtattgctcaggctctgcaccttcaaggtgcagagctagcattcacgtatcag
tgtgataaatttaaatcaagagttgaagggttcgccgccgattttaattccaatattgta
ttgccatgcgatgtgacgacagatgctaatatcaaagcactatttaaacacttggctaaa
gtttggccaacctttagcggctttgtacatgctattgcttattcgcctgttaatcaattg
aacggcgattatgtaaacacagtaacccgtgaagggttcactatcacgcacaatatcagc
gcatatagttttgttgcaatggctaaaagcagtaggtgtatgctgaattctaattcagca
ttgctgacgcttacttaccttggtgccgaacgtgctattcctaattataacgtcatgggc
ctagctaaggcctctttagaggctaatacccgttacatggctaacgctatgggaccacaa
ggtgtccgggttaatgccatttctgctggtcctatccgtactttagctgcatctggtatt
aaacagttcaaaaagatgttgcaccactatgagtcggtggcaccactacgtcgtgtagta
accattactgatgttggtaatactgccgcctttttatgctctgatttatctgctggcatt
actggcgaggtaatacatgtggacaacggttttaatattgctacgatgaacgatattgct
tttgattga

DBGET integrated database retrieval system