KEGG   Methylovorus sp. MP688: MPQ_0175Help
Entry
MPQ_0175          CDS       T01361                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
mep  Methylovorus sp. MP688
Pathway
mep00030  Pentose phosphate pathway
mep01100  Metabolic pathways
mep01110  Biosynthesis of secondary metabolites
mep01120  Microbial metabolism in diverse environments
mep01130  Biosynthesis of antibiotics
mep01200  Carbon metabolism
mep01230  Biosynthesis of amino acids
Module
mep_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mep_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
mep_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MPQ_0175 (rpiA)
Enzymes [BR:mep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MPQ_0175 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC MGS
Motif
Other DBs
NCBI-ProteinID: ADQ83364
LinkDB All DBs
Position
190571..191227
Genome map
AA seq 218 aa AA seqDB search
MATQDELKQQVAKAAVEYVKGGIIGVGTGSTANFFIDELAKVKSKIDGAVASSEATAQRL
RAHGIEVFDLNSVDGMEIYVDGADEITEHMHMLKGGGGALTREKIVAACAKTFICICDAS
KYVPVLGKFPLPVEVLPMARSHVARELTKLGGQPKLRDFTTDNGNIILDVHGLEILNPVE
MEAKINQIVGVVTNGLFAARPADVLLLATPEGVKTYKR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaagacgaattgaaacaacaagtagcgaaggccgcggttgaatacgttaag
ggcggcattattggggtaggcactggctctactgccaacttttttatcgacgaactggcc
aaggtcaaaagcaagattgatggcgcggtagcaagctcggaagccactgcacagcgtttg
cgcgctcacggcattgaagtatttgacctcaatagcgtggatggcatggaaatctatgtc
gatggcgccgatgaaatcaccgagcacatgcacatgctgaaaggcggcggtggtgctttg
acccgcgaaaaaatcgtcgcagcctgtgccaagacatttatctgtatctgtgatgccagc
aagtacgtgcctgtgctgggcaaattcccgctgccagtagaagtattgcccatggcccgc
agccacgtggcacgcgagctgaccaagctgggcggtcaacccaagctgcgcgactttacc
accgataacggcaacatcattctggacgtgcatggcctggaaatcctcaacccggttgag
atggaagccaagatcaaccagatcgtgggtgttgtcaccaacggtttgttcgccgcgcgt
cctgcagatgttctgctgttggccacgccggaaggtgtgaagacatacaagcgctaa

DBGET integrated database retrieval system