KEGG   Methylovorus sp. MP688: MPQ_0228Help
Entry
MPQ_0228          CDS       T01361                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mep  Methylovorus sp. MP688
Brite
KEGG Orthology (KO) [BR:mep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MPQ_0228 (ahpF)
Enzymes [BR:mep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MPQ_0228 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_7 AlaDh_PNT_C K_oxygenase FMO-like NAD_binding_8 YhdX Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADQ83417
LinkDB All DBs
Position
242307..243851
Genome map
AA seq 514 aa AA seqDB search
MLDDTLKTQLQTYLGMLRQPIRLIASLDGSEKAAEMRELLQDIAALSDKVSLDLAGSDAR
KPSFVIAREGETSGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEADVIEQIKALDGDFRF
EVYMSLSCHNCPDVVQATALMAILNPKVQTTVIDGALYQDEVNGRNIMAVPTTYMNGEPF
GSGRMTVEEMLTKLDTGAEAREAAKLDQKAPYDVLIVGGGPAGASAAIYAARKGIRTGIV
AERFGGQVMDTLGIENFISVKETEGPKLVAALEEHVRSYDVDIINLQRAESITRGELVEV
KLAGGATLKSKAVIAATGARWRELNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGFVGHVTLIEYDTKLRADAVLQNKLFSLPNVTVIINAQTTEVTGDSQKVN
GLVYKDRATSVDHHLELEGVFVQIGLLPNTDWLKGSDVELSKFGEIKVDAHGQTSMAGVF
AAGDVTTVPYKQIIIAMGEGSKAALGAFDYLIRQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgatacactcaaaactcaacttcagacctatttgggcatgctgcgccagcct
atccggttgattgcttcactcgatggcagtgaaaaagccgctgaaatgcgtgagctgctg
caagacattgccgcgctgtcagacaaggtcagcctggacctggcaggcagtgatgcccgc
aagccttcgttcgtgattgcacgtgaaggtgagaccagtggcgtgcgctttgctgccatt
ccgctgggccatgagtttacgtcgctggtgctggccttgttatggaccggcggtcaccca
cccaaggtcgaagccgatgtgattgaacagatcaaggcgctggatggcgatttccgcttt
gaggtgtacatgagcctgtcctgccataactgcccggacgttgtgcaggcaacggcattg
atggccattctcaaccccaaagtgcaaaccaccgtgattgatggtgccttgtatcaggat
gaagtgaatggtcgcaacatcatggccgtgcccaccacctatatgaacggtgagccattt
ggctcgggccgcatgacggttgaagaaatgctgaccaagctcgataccggggctgaggca
cgcgaagcggccaagctggaccagaaggcaccttatgatgtgctgatcgtaggcggtgga
cctgcgggtgcttcggcggccatctatgccgctcgcaagggcatacgtaccggtatcgtg
gccgagcggtttggcggccaggtgatggataccctgggcattgaaaacttcatctcggtg
aaggaaaccgaagggcccaagctggtggccgcactcgaagagcatgtgcgcagctacgat
gtcgatatcatcaatctgcaacgcgccgagtcgattacgcgcggcgaactggtcgaggtg
aagctggcaggtggcgcaacgctgaagagcaaggcagtgattgcggctaccggtgcccgg
tggcgcgagctgaatgtgcctggcgagaaggaataccgtggcaagggcgtggcgtattgc
ccacactgcgatggtcctttgttcaagggcaaacgcgtcgccgtgattggcggtggcaat
tcaggtgtagaggcagcgattgatctggccggttttgttggccatgtcaccctgatcgaa
tacgacaccaagttgcgtgcggatgcggtgctgcagaacaagttgttcagcttgcccaat
gtgaccgtgatcattaacgcgcaaacgaccgaagtaaccggcgattcccaaaaggtcaat
ggtttggtgtacaaggaccgcgccacaagcgtggatcatcacctggaactggaaggtgtc
tttgtacaaatcggtctcttgccgaataccgactggctcaagggcagtgatgtcgaactg
agcaagtttggtgagatcaaggtggatgcgcatgggcagacatcaatggcaggtgtgttt
gcggcgggggatgtgacgaccgtgccttacaagcagatcatcattgccatgggtgaaggc
tccaaggctgcgctgggcgcatttgattacctgatacgccagtaa

DBGET integrated database retrieval system