KEGG   Methylovorus sp. MP688: MPQ_1244Help
Entry
MPQ_1244          CDS       T01361                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mep  Methylovorus sp. MP688
Pathway
mep00010  Glycolysis / Gluconeogenesis
mep00620  Pyruvate metabolism
mep01100  Metabolic pathways
mep01110  Biosynthesis of secondary metabolites
mep01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPQ_1244
   00620 Pyruvate metabolism
    MPQ_1244
Enzymes [BR:mep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MPQ_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ADQ84408
LinkDB All DBs
Position
complement(1257507..1259027)
Genome map
AA seq 506 aa AA seqDB search
MSLESLKGLGVEIPYQAKYDNYIGGKWVAPVDGEYFDNISPVTGKVFCKVARSNDKDVNL
ALDAAHAAKEAWGKTSTTARSNILLKIADAMEANLEKIAIAETIDNGKPIRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCIVMKPAEQTPASILVVMEIIGHLLPPGVLNVVNGFGVEAGKALATSPRIAKIAFTG
STSVGRLIMQYASQNLIPVTLELGGKSPNIFFEDIMDADDAYFDKCLEGFTLFALNQGEV
CTCPSRALIQESIYEKFMERALKRVKAIKQGNPLDASTMIGAQASSEQVEIIMSYIKLGR
EEGAEVLTGGNVTKLAGELGEGYYIEPTVFKGHNKMRIFQEEIFGPVLSVTTFKDEAEAL
AIANDTMYGLGAGVWTRDGSRAFRMGRGIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYNPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggaaagcttgaagggcctgggtgttgagattccatatcaggccaaatatgac
aattacattggcggtaaatgggtagctcctgtagacggcgaatatttcgataacatcagc
ccggtgactggcaaagtgttctgcaaggtcgcccgctctaacgataaggatgtcaacctg
gcactggatgcggcacatgccgccaaggaagcctggggcaagacctcgaccacagcccgc
tccaatattctgcttaaaatcgccgacgcgatggaagccaaccttgaaaaaatcgcgatt
gccgaaaccatagacaacggcaagcccatccgcgaaaccatggcggcagatatcccgctc
gccattgatcacttccgttactttgctggcgcggtgcgcgctcaggagggcggcatcagc
gaaatcgaccacgacaccattgcctatcacttccatgaaccactgggcgttgtcggccag
atcattccctggaacttcccgattctgatggcggcatggaaactggcaccagccctggct
gctggcaactgtattgtcatgaagccggccgaacaaacgccagcttccattctggtggtt
atggaaatcatcggtcacctgctgccacctggcgtgctgaatgtggtcaacggctttggc
gtagaagcaggcaaggcgctggccaccagcccacgcatcgccaagatcgcctttaccggc
tccacctccgtgggtcgcctgatcatgcaatacgcatcgcaaaacctgattccagtgacg
ctggaactgggtggcaaatccccgaacatcttctttgaagacatcatggacgccgacgat
gcttacttcgataaatgtctggaaggtttcaccctgtttgcattgaaccagggcgaagtc
tgcacctgtccttcgcgtgccctgattcaggaatccatctacgagaaattcatggagcgc
gcacttaagcgcgtcaaggctatcaagcagggtaacccgctggatgcttcgaccatgatc
ggtgcgcaagcatcgagcgagcaggtcgagatcatcatgtcttacatcaagctgggccgt
gaagaaggcgcggaagtgctgaccggcggcaacgtcaccaagctggctggcgaactgggc
gaaggctattacatcgagcctaccgtgttcaagggccataacaagatgcgcattttccag
gaagaaatcttcggccctgtgctgtcggtgaccaccttcaaggatgaagccgaggctctg
gcgattgccaatgacaccatgtacggcctgggtgccggtgtgtggacgcgtgatggcagc
cgtgccttccgcatgggccgtggcattcaggctggccgcgtgtggaccaactgctaccac
ctctaccctgcccatgccgccttcggtggttacaagcaatcgggtatcggtcgtgaaaac
cacaagatgatgctggatcactaccagcagaccaagaacctcctggtcagctacaaccct
aacgcattgggctttttctaa

DBGET integrated database retrieval system