Methylovorus sp. MP688: MPQ_1459 Help Entry MPQ_1459          CDS       T01361                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mep  Methylovorus sp. MP688 Pathway mep01100   Metabolic pathways mep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MPQ_1459   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MPQ_1459 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF1896 EutQ DUF6137 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  ADQ84618 LinkDB All DBs Position complement(1495196..1495432) Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIVSEQLGANEADVKNESSFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKITTVQQAIDYVSANLK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgacatcgaacaacgcgttaaaaagatcgtttctgagcaattgggtgcaaatgaa gctgatgtaaagaatgagtcttcctttgtagatgacctgggtgctgattcgctcgacacc gttgaactcgtgatggcacttgaagaagaatttgattgtgaaattcctgatgaagaagca gagaagatcacaaccgttcagcaagcgattgactacgtcagcgccaacctcaagtaa

DBGET integrated database retrieval system