KEGG   Methylovorus sp. MP688: MPQ_1713Help
Entry
MPQ_1713          CDS       T01361                                 

Gene name
dppD
Definition
(GenBank) peptide/nickel transport system ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
mep  Methylovorus sp. MP688
Pathway
mep02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mep00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MPQ_1713 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mep02000]
    MPQ_1713 (dppD)
Transporters [BR:mep02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    MPQ_1713 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N Sigma54_activat AAA_22 RsgA_GTPase AAA AAA_7 AAA_21 AAA_29 RP1-2 ResIII AAA_16
Motif
Other DBs
NCBI-ProteinID: ADQ84867
LinkDB All DBs
Position
complement(1759438..1760274)
Genome map
AA seq 278 aa AA seqDB search
MTALLRMEELTVVPVKSPQRKLVNQVSFVLESGKTTCVVGESGSGKSLTALSVMGLLSEQ
LQRIHGRVIFQGRDLASLSSEEMRGIRGKQIGMIFQEPMTSLNPVLKVGYQIGESLTEHL
GLRGKALRAKVGSLLEQVGIPAERADSYPDELSGGQRQRVMIAMSIACEPAMLIADEPTT
ALDVTVQAQILKLLDELKTRMNMGMLFITHDFGVVADIADDVVVMFRGEIVESGPVAEVL
GNPQHPYTKALLDCVPDADGKKPLKPIDYAWLTNGAHP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgccttgctgcgcatggaagaactgacggttgtcccggttaaatcgccccagcgc
aagctggttaatcaggtatcttttgtgctggagtcaggcaaaaccacttgcgtggtgggc
gagtcgggcagcggcaaaagcctcacagcgctgtcggtgatggggcttctgtccgagcaa
ctgcagcgaatccatggccgtgtcatttttcaggggcgtgatctcgcctccctgagttcc
gaagaaatgcgcggcatacgcggcaagcaaattggcatgatttttcaggagccgatgacc
tcgctgaatcctgtgctgaaggtgggctaccagataggcgagagcctgaccgaacatctt
ggcctgcgtggaaaagccttgcgggcaaaggtaggcagcctgcttgagcaggtcggcata
ccggcagagcgtgcagacagttatcccgatgagctttctggtggacaacgccagcgtgtg
atgattgccatgagtattgcctgcgagccagcgatgctgattgccgatgaaccgacgacc
gcgctggatgtgaccgtgcaagcacagattctcaaattgctggacgaactcaagacccgc
atgaacatgggcatgctgtttattacccatgattttggcgtggtggcggatattgctgac
gatgtggtggtcatgttccgtggcgagattgtcgagtccggcccggtggcggaggtgctc
ggcaatccgcagcatccttataccaaggccttgctggattgtgtgcccgatgccgatggt
aaaaagccgttaaagccgattgattatgcctggctaacaaatggagcccacccatga

DBGET integrated database retrieval system