KEGG   Methanosarcina sp. WWM596: MSWHS_0357Help
Entry
MSWHS_0357        CDS       T03852                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
meq  Methanosarcina sp. WWM596
Pathway
meq00500  Starch and sucrose metabolism
meq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSWHS_0357
Enzymes [BR:meq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MSWHS_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AKB17220
UniProt: A0A0E3NHR9
LinkDB All DBs
Position
433771..434961
Genome map
AA seq 396 aa AA seqDB search
MTSLCMYFQVHQPFRLRRFWPDDRAGFFRYFDERSNREIFERVTHKCYLPANRALLDSLD
EHKGEFRFSLSITGTLLEQCELWGKEVLESFRQMAETGAVEFLDETCYHSLSSLFDDKTE
FIEEVKEHRKMVFDLLGVKPQVFRNTELLYNNTIAKIASELGYKAILTEGADHMLDGRSP
NVLYMAKGSGLPILFRNYKLSDDIGYRFSARWWEGYPLTAEKWASWASGVKEDCVNIFMD
YETFGEHQWEETGIFKFLERLPAEVLKNGMEFSTPVEIARKYSPVAEIDIGDFSTISWAD
MERDTSAWLGNDMQRRCFEEIKLLEPFVRKTGDPEILRIWKHLLTSDHYYYMCTKWLGDG
DVHSYFSVHSTPFEAAVNFMAVLMDFKARVFRSLMQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacctctctttgtatgtactttcaggtacatcagcctttcaggctgcgcaggttctgg
cctgatgacagggctggctttttccgctattttgatgaaagaagcaacagggagattttt
gaaagagtaactcataaatgttacctccctgcaaatagggctctcctggactccctcgac
gagcataaaggagagttcagattttccctgtcgattactggtacactgcttgaacaatgc
gaactctggggaaaagaggtacttgagagtttccggcagatggcggaaacaggagcagta
gagtttctggacgagacatgttatcattctctctcaagcctttttgacgacaaaacagag
tttattgaagaagtaaaggaacaccgaaaaatggttttcgacctccttggggtcaaacct
caggtattccgaaacaccgaacttctttacaataacaccatagcaaagattgcttccgag
cttgggtacaaagcgatccttacagaaggagcagaccatatgcttgacgggaggtctccc
aacgtactctacatggcaaaaggttcaggcctgcccattcttttcaggaactacaagctg
agcgacgatatagggtaccgtttttcggcaaggtggtgggaaggatatccacttactgcg
gaaaaatgggcgtcgtgggcttcaggggttaaggaggactgcgtcaatatttttatggac
tacgagacttttggagagcaccagtgggaagaaaccggaatttttaaattcctggaaaga
ctgcctgcagaagtcctcaaaaatggaatggaattcagcactcctgtagagattgccaga
aaatattcccctgtagccgagatcgatattggagacttttcaactatttcctgggctgat
atggaacgtgataccagtgcgtggcttggaaacgacatgcaaaggcgttgttttgaggaa
ataaaattgcttgagccttttgtgagaaaaacaggagaccccgaaatcctgcgtatatgg
aagcacctgttgacttcggaccactattactatatgtgtaccaagtggctcggggatgga
gatgtgcattcttatttcagtgtccactccacacctttcgaggcagcagtaaactttatg
gcagtacttatggacttcaaggctcgtgtattcaggagcttaatgcaataa

DBGET integrated database retrieval system