KEGG   Methanosarcina sp. WWM596: MSWHS_1751Help
Entry
MSWHS_1751        CDS       T03852                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
meq  Methanosarcina sp. WWM596
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: AKB18614
UniProt: A0A0E3NKE0
LinkDB All DBs
Position
complement(2157278..2157736)
Genome map
AA seq 152 aa AA seqDB search
MLEEYAKKRDFKKTSEPPVNELEKSSGKPIFVVQRHDATNLHYDFRLEMDGVLKSWAVPK
EPPKKAGIRRLAIQTEDHPLEYADFEGKIPEGEYGAGKVEIWDKGTFELLKRNEKEITVT
LEGEGLKGVYVLIRTNYGKKGKGWLFFKKKAD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaggaatatgcgaagaagagagattttaaaaagacctccgaacctccagttaat
gagttagaaaaaagttccggtaaacctatttttgtggtccagcgccatgatgcaaccaac
cttcattatgattttcgcttggagatggacggagtcctgaaaagctgggcagtccctaag
gagccgcctaaaaaagccggcatcaggaggcttgccatccagactgaagaccacccactc
gaatacgccgattttgagggaaaaatcccagaaggagagtacggagccggtaaggttgaa
atctgggataaaggtacttttgagcttttgaagcgtaacgagaaagaaattactgtcaca
cttgagggggaagggctgaaaggggtttatgtgctgataaggacaaactacggtaaaaag
ggtaaagggtggcttttttttaagaaaaaagccgattga

DBGET integrated database retrieval system