KEGG   Methanosarcina sp. WWM596: MSWHS_3282
Entry
MSWHS_3282        CDS       T03852                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
meq  Methanosarcina sp. WWM596
Pathway
meq00300  Lysine biosynthesis
meq01100  Metabolic pathways
meq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:meq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSWHS_3282
Enzymes [BR:meq01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSWHS_3282
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AKB20145
UniProt: A0A0E3NMJ0
LinkDB
Position
3981922..3982701
AA seq 259 aa
MALLTPEDLENINRQLHEADSAVRRVTGLDIKGVCKDFYGTTPCCEKIGIVPVTSGNGII
GNFSESLHAITEYFGFDSFVTDIPDVSGYYEAVRNGAQIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYLKADSKDVLAVGLGKVGFPGVAHFVHKGFRVYGYDADSTILEKT
ASSLGITPFDPNNPRKFSIIFEATPCADTVPESVISENCVISTPGIPCAISNELQKKYGV
ELVMEPLGIGTASMLYSIL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagacctggaaaacattaacagacagcttcatgaagctgat
tctgctgtccggagagttacagggcttgatataaaaggagtctgcaaagacttctacggc
acaaccccatgctgtgaaaaaataggcattgtacctgtgacctcgggaaacgggatcata
ggaaacttctcggaatccctgcatgcaattacagaatatttcggatttgacagttttgtt
acggatattcctgacgtgagcgggtactacgaggcagtaaggaacggagcgcaaattatc
cttatggcggacgacaataccttccttgcccataacctcaaaaacggaaaaatagccaac
aaccagccctgtacaggcataatttatgcggaaatagcctccagatacctgaaagccgat
tcaaaggatgtgcttgctgttggcctgggaaaggtgggctttccgggagtagcgcacttc
gtacataaaggcttcagggtctacggatatgatgctgacagcacaatcctcgagaaaacc
gcatccagcctcgggattactcctttcgaccccaacaaccccagaaaattctccattatt
ttcgaggctaccccctgtgcggacacggtccccgaatccgtgatttcagaaaactgcgta
atttccacccccggaatcccctgtgctatttccaacgagcttcaaaagaagtacggagtt
gaacttgtaatggaacctctcgggatagggacggcatcaatgctgtattcgattctctaa

DBGET integrated database retrieval system