KEGG   Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1: MMINT_07580Help
Entry
MMINT_07580       CDS       T02692                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
mer  Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
Pathway
mer00220  Arginine biosynthesis
mer00250  Alanine, aspartate and glutamate metabolism
mer00270  Cysteine and methionine metabolism
mer00330  Arginine and proline metabolism
mer00350  Tyrosine metabolism
mer00360  Phenylalanine metabolism
mer00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mer00401  Novobiocin biosynthesis
mer01100  Metabolic pathways
mer01110  Biosynthesis of secondary metabolites
mer01130  Biosynthesis of antibiotics
mer01210  2-Oxocarboxylic acid metabolism
mer01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mer00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMINT_07580
   00270 Cysteine and methionine metabolism
    MMINT_07580
   00220 Arginine biosynthesis
    MMINT_07580
   00330 Arginine and proline metabolism
    MMINT_07580
   00350 Tyrosine metabolism
    MMINT_07580
   00360 Phenylalanine metabolism
    MMINT_07580
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MMINT_07580
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    MMINT_07580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mer01007]
    MMINT_07580
Enzymes [BR:mer01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     MMINT_07580
Amino acid related enzymes [BR:mer01007]
 Aminotransferase (transaminase)
  Class I
   MMINT_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase DUF498
Motif
Other DBs
NCBI-ProteinID: AGN26124
UniProt: R9T6A8
LinkDB All DBs
Position
complement(768996..770114)
Genome map
AA seq 372 aa AA seqDB search
MVSKKVQSIKPSGVRAIFDMAQEDSINLGLGELDFRPPREVTEACKKALDSDSYRYGPTM
GIPALREKIANKISRFNKDIKTSNVMITSSGTQAAMATFQTLFQEGDEVLVPDPGFVVYA
PECTLCGADPVPYTMDDELNIDLEKIKEGITKKTKGIVVNSPANPCGSVLTEEAFKTICD
LAEDYNLWIISDEVYENFIYEGKHYSFNEYLDRSVVLNSFSKSFAVAGWRVGYLSAPDSI
ISEISKMQYHILACPPSPFQYALNDAFDCQEDFINEIFPILKKRRDLTTDLLNEIHGFSC
IKPRGAFYAFPSYDIDIPSADLAVKLAHQGVLCSPGTAFGDAGEKHLRISYAASEDNIEK
GIEIIKNFVENF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtttctaaaaaagttcagtctatcaaaccttctggagttcgtgccatttttgacatg
gctcaggaagacagtatcaatttaggattaggagaacttgacttcagaccgcctcgggaa
gttactgaagcctgcaagaaagcgctagactctgattcttatcgctacggacctacaatg
ggcattcctgctctcagagaaaaaatagccaataagatatctagattcaacaaagatatc
aaaacgtcaaacgtgatgataacatcaagcggcactcaggcagccatggcaacattccag
acgctgtttcaagaaggagatgaggttcttgtccccgatccaggatttgtagtatatgca
ccagaatgcacgctctgcggagctgatcctgtaccatacacaatggatgatgaattaaat
atagacttagaaaaaataaaagagggcataactaaaaaaactaaaggaattgttgtcaac
tctcctgcaaatccctgcggatcagttctcactgaagaagcattcaaaacaatatgtgac
ttagcagaagactataatttatggatcatctctgatgaagtgtatgagaatttcatatac
gaagggaaacattactcattcaatgagtatctagatagatcagtcgtgttaaattcattt
tcgaagtcatttgctgtagccggctggagagtgggatacttatctgcaccagatagcata
ataagcgagatttccaaaatgcagtaccatattcttgcatgtccccccagtcctttccag
tatgctctaaatgatgcattcgactgtcaggaagattttataaatgaaatttttccaatc
cttaaaaaacgtcgcgatcttactacagatttgctgaacgagattcacggattttcatgc
attaaacccaggggagcgttttatgcatttccatcatatgacatagatataccatctgcg
gacttagctgtaaaacttgcacatcagggagtgctttgttcacctggtactgcatttgga
gacgctggagaaaagcatctgagaatatcatatgctgcctctgaagataatattgaaaaa
ggaatagaaatcataaaaaatttcgtagagaacttttaa

DBGET integrated database retrieval system