KEGG   Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1: MMINT_16520Help
Entry
MMINT_16520       CDS       T02692                                 

Definition
(GenBank) Ribulose-5-phosphate 4-epimerase-related epimerase/aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mer  Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
Pathway
mer00051  Fructose and mannose metabolism
mer01100  Metabolic pathways
mer01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MMINT_16520
Enzymes [BR:mer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MMINT_16520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGN26949
UniProt: R9T8G7
LinkDB All DBs
Position
complement(1649610..1650224)
Genome map
AA seq 204 aa AA seqDB search
MNEQLSQDLADVGRLLYEKRLTIASGGNMSVRAGNSMLITPSGVCKGMLSGRDMIEIDIS
SGEIIGKGKPSIETPFHLGIYRSRPDVNAVIHCHPVSCTVLAIQKKDLRTNLTPESLMIL
GKDVPMIPYDTPGSDGLAEKLIATMGPSKACLMQNHGALVVGKDLMDAFFRMETLEYIAT
LQLKCGEVPGLPEDEIERVLAMSK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaactttctcaggatctggctgatgtcggcaggctgctttatgaaaagcgt
ctgacaattgccagcggcggcaatatgagtgtaagggctggcaactctatgttgatcact
ccgtcaggtgtctgcaaaggaatgctttccggtcgcgatatgattgaaattgatatttca
tcaggagagataatcggaaaaggaaaaccatcaatcgagactcccttccatttagggatc
taccgttcccggcctgatgtaaatgcagtcatccactgccatcctgtttcttgcacagtt
cttgccatccagaaaaaagatctccgtacgaatcttactccagaatctttaatgatccta
ggaaaagatgtgccgatgataccttacgatactccaggttcagacggcttggctgagaaa
ttaattgccactatgggaccaagcaaagcctgcctgatgcagaaccacggcgctttggta
gtcggcaaagatctgatggatgccttcttcagaatggaaacccttgaatacattgccact
ttacaattgaaatgcggtgaggtacccggtcttccagaagatgaaatcgaaagggtactt
gctatgagcaaatga

DBGET integrated database retrieval system