KEGG   Chelativorans sp. BNC1: Meso_0861Help
Entry
Meso_0861         CDS       T00374                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mes  Chelativorans sp. BNC1
Brite
Enzymes [BR:mes01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Meso_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Acid_phosphat_B TetR_N
Motif
Other DBs
NCBI-ProteinID: ABG62261
UniProt: Q11K14
LinkDB All DBs
Position
955608..956210
Genome map
AA seq 200 aa AA seqDB search
MAFELPDLPYDYEALQPYMSKETLEFHHDKHHKAYVDTGNKLAAEAGLDNLSVEEIVKQS
YGKNQPLFNNAGQHFNHVHFWKWMKKGGGGKSLPGALQTAIDSDLGGYDKFRNDFVQAGM
TQFGSGWAWIAVKNGKLEIMKTPNGENPLVHGGAPILGVDVWEHSYYIDYRNARQKYLEA
FVDNLVNWDYVLELYEKARG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaactgccggacctgccctacgactatgaagctttgcagccttacatgtcg
aaggaaacgctggaattccatcacgacaagcatcacaaggcctatgtggacacaggcaac
aagcttgcggccgaagccgggctcgacaacctctcggtggaggaaatcgtcaagcagtcc
tatggcaagaatcagccgctcttcaacaatgccggccagcatttcaaccacgttcatttc
tggaaatggatgaagaagggtggcggcggcaagagcctgcccggcgcgctgcagacggcg
atcgacagcgatctcggcggctatgacaagttccgcaacgatttcgtgcaggccggcatg
acgcagttcggctctggctgggcatggattgcggtcaagaacggcaagctcgaaatcatg
aagacgccgaatggcgagaacccgctggtccatggcggcgcgccgattctcggtgtcgat
gtctgggagcactcctattacatcgattaccgcaacgcccggcagaaatatctggaagcc
ttcgtcgataatctcgtcaactgggactacgtcctggagctttacgaaaaggcgcgcggc
tga

DBGET integrated database retrieval system