KEGG   Chelativorans sp. BNC1: Meso_1150Help
Entry
Meso_1150         CDS       T00374                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD phosphoesterase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mes00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Meso_1150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mes03400]
    Meso_1150
Enzymes [BR:mes01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Meso_1150
DNA repair and recombination proteins [BR:mes03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Meso_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABG62546
UniProt: Q11J79
LinkDB All DBs
Position
1256494..1259031
Genome map
AA seq 845 aa AA seqDB search
MALTTYRRKRNFSATPEPPGEEKASPRGDSFVIQKHAARRLHYDLRLEMDGVLKSWAVTR
GPSLVPGEKRLAVHVEDHPLDYGDFEGTIPKGEYGGGTVIVWDRGSWSPIGDAKKGYAKG
HLEFELHGEKLTGRWHLVRMAKKPREKKENWLLIKGEDDAARSEADPDILEERPESVKTG
RVIEEVEGEAPGWSSKTGRIEQPAEAKPARKKRATKAGSEKSAGEKISVPKRAKKAGYPG
FIEPALATLRSTPPPGGRWLHEIKFDGYRLQAHIRDGKARLLTRSGLDWTEKFGDAIVTA
LGSLPVRQAIMDGELIVEGAGGASDFSALQAALSEGRVDRMALYLFDLLYLDGYDFRPVP
LAERKATLQKLLDGAPPVLRYSEHFEEDGELVFRHACRLSLEGIVSKAGDAAYRSGRGKD
WIKSKCSMRQEFVVAGYVPSTTSNRAIGSLVLGYYENERLIYAGRVGTGFSHALAQDLFK
RLDKMRIAKSPFAKKLTSEEARGAKFVRPELVAEVEFRTWTADNLIRHASFRGLREDKSA
TDVTRETNQSKPAERAAPAIRLTHPDRIYWKDAGVTKQGLSDYYAEVWPRMGPFIVNRPL
ALVRCPDGVEGQCFFQKHAWRGQSHEIMKAVDPEDDEPIIAIDGLPGLIGLVQGGTLEIH
PWGSQLEDLERPDLINMDLDPGPDVTWQDVIDAAREVRERLAQAGLESFVKTSGGKGLHV
VAPLKPRADWPEVKAFAKGIADAMASDTPERFVATVTKAKRKGKILVDYLRNGRGATAVA
PYSTRARAGAAVSMPLFWEELSPAITADYFTVANAPTRLAAIGKDPWEDFWRAAVPLGRK
ARRAA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaccacctatcgcaggaagcggaacttttcagctacgcccgagcctccgggt
gaggagaaggcttcgccgcgcggcgatagtttcgtgatccaaaagcacgccgcgcgccgc
cttcattacgatcttcggctggagatggatggggttctcaagagttgggcggtcacgcgc
gggccgagtctcgtgccgggcgaaaagcggcttgccgtccatgtggaggatcacccgctc
gattatggcgatttcgaagggaccattcccaagggcgaatatggcggcgggaccgttatc
gtctgggaccgcggaagctggtctccgatcggtgatgcgaaaaagggttatgccaagggc
catctggaattcgaattgcacggcgagaagctgacgggccgctggcatctggtgcgcatg
gcgaagaagccgcgcgagaagaaggaaaactggctgctcattaagggcgaggacgatgcc
gcgcgcagcgaggctgatccggatattctggaggagcgcccggagtcggtgaaaaccgga
cgggtgatcgaagaggtggaaggcgaggcgccgggctggtcgtcgaagaccgggcggatc
gagcagccggcggaggcaaaaccggcgcggaagaagcgcgcgaccaaggccggtagcgag
aaatccgctggcgagaaaatttcggtacccaagcgggcgaagaaagcgggctatcccggc
ttcatagagccggcgctcgccacattgcgcagcacgcctccgcccggcggcaggtggttg
cacgagatcaagttcgacggctatcggctgcaagcgcatatccgcgacggcaaagcgcgg
ctattgacgcgcagcggcctcgactggaccgaaaaatttggggacgcgatcgtgaccgcc
ttgggcagccttcccgtccggcaggccattatggacggagaactgatcgtggagggagcg
ggcggcgcttcggacttctccgccctccaggcagcgctatccgaaggtcgcgtcgaccgc
atggcgctctatctgttcgacctgctctatcttgacggctacgacttccgccccgttccg
ctggctgagagaaaagccaccctccagaagctcctcgatggcgcgccaccagtcctgcgc
tacagcgagcatttcgaagaggatggcgagcttgttttccgccatgcctgccgcctgagt
cttgaaggcattgtctcgaaggccggcgatgcggcctatcgttccgggcgcggcaaggat
tggatcaagtcgaaatgttccatgcggcaggagttcgtcgtcgcgggttacgtgccatcc
accacctccaaccgcgccatcggttcactggtgctgggctattatgaaaacgagcggttg
atatatgccggccgtgtcggcaccggcttcagccatgcgcttgcgcaggatcttttcaag
cgtctggataaaatgcgcatcgcgaaaagccccttcgcaaagaagctgacgtctgaagaa
gcgcgcggcgcgaaattcgtgcggcccgagctcgtggcggaagtggagtttcggacttgg
acagccgacaacttgatccgccatgcctccttccggggtctgcgggaggataaaagcgcg
acggatgtcacccgcgagacgaaccaatccaagcccgccgagcgcgcggcgcctgcaatc
aggcttacgcacccggaccggatttactggaaggatgccggtgtcaccaagcaggggctc
tcggactattatgcggaagtctggccgcgcatgggtcctttcatcgtcaatcgtccgctg
gcgcttgtgcgctgtcccgatggtgttgagggccagtgcttctttcagaagcatgcctgg
cgcggtcaatcccacgagatcatgaaagccgtagacccggaggacgacgagcccattatc
gccatcgatggtctgccgggcctgatagggcttgtgcagggcggcacgctggagatccac
ccgtggggatcgcaactggaggatctggagcgccccgacctcattaatatggaccttgat
cctggcccggatgtcacctggcaggacgtgatcgatgccgcaagggaggtgcgcgagcgg
ctggcgcaagcgggccttgaaagctttgtgaagacgtccggcggcaagggcctgcatgtt
gtggcgccgctgaagccgcgcgcggattggcctgaggtgaaggccttcgcaaagggcatc
gccgatgcgatggcttccgacacacccgagcgcttcgttgccaccgtgacgaaagccaag
cgcaagggaaagatccttgtcgactatcttcgcaacggcaggggggcgacggccgtcgca
ccctattccacacgggcgcgggcgggggcggcggtgtcgatgccgctgttctgggaggaa
ctgagccccgccatcaccgccgattattttaccgtggccaatgctccaacacgtttggcc
gccattgggaaggacccgtgggaggatttttggcgggcggcggtgccgcttggcaggaag
gcgcgccgcgccgcgtga

DBGET integrated database retrieval system