KEGG   Chelativorans sp. BNC1: Meso_1591Help
Entry
Meso_1591         CDS       T00374                                 

Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00564  Glycerophospholipid metabolism
mes01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mes00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Meso_1591
Enzymes [BR:mes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Meso_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_binding_2 FAD_oxidored NAD_binding_8 GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABG62986
UniProt: Q11HY9
LinkDB All DBs
Position
1713176..1714705
Genome map
AA seq 509 aa AA seqDB search
MDGTPVHDILVIGGGINGCGIARDAAGRGYSVFLAEMNDLGSGTSSGSTKLIHGGLRYLE
FYEFRLVREALLEREVLWRNAPHIIWPMRFVLPHNEGLRPAWLLRLGLFLYDHLGGRKLL
PKTRTIDMRIDAAGKPLKPLFSRAFEYSDCWVDDARLVVLNARDAADRGAVIATRTEVVD
ARREDGRWRATLRDVSSGARSEVRARLVVNAAGPWVDKVLASAMGRNEVHNVRLVKGSHI
VVPKVSDDPRAYFFQNRDGRIIFAIPYEDDFTLIGTTDQDYDGEPRDAAISPAETDYLCA
AASEYFARPVRREDIVWTYAAVRPLFDDGASKAQEATRDYVLRVEEGDGDAALVNIFGGK
ITTYRRLSEATLEKIEELLGRKGQAWTADARLPGGDFAVDGFDGQIAGLLRDYPFLNAGH
ARRLVRRYGTRARAILGQARSTDDLGVHFGADLYEAEVRYLMEQEWARTAEDVLWRRTKR
GLRLAPNEVVTLEEFMEDLASRRRHEAAE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggacggcactccggtccatgacattcttgttatcggcggcggcatcaatggctgcggc
atcgcgcgggatgcagcaggccggggatacagcgtctttctcgcggaaatgaacgacctt
ggaagcggcacgtcgtccggctccaccaagctcatccatggcggcctgcgctacctcgaa
ttctatgagttccggcttgtgcgggaggcgctgctcgagcgcgaggtgctgtggcgcaac
gcgccgcacattatctggccgatgcggttcgttctgccgcataatgaggggctgaggcca
gcctggctgctgcgtctcggcctcttcctctatgaccatctcggcgggcgcaagctcctt
cccaagacgcgtacgatcgatatgcgcatcgatgctgccggcaagccgctcaagccgctc
ttttcccgcgccttcgaatattccgattgctgggtcgacgacgcccgcttggtggtgctc
aacgcgcgggacgcggccgaccggggcgcggtgatcgccacccgcaccgaggtggtcgac
gcgcgccgggaggatggccgatggcgggcaacgctgcgcgatgtctcgagcggcgcgcgg
tccgaggttcgggcgcgccttgtcgtgaacgccgccggcccctgggtggacaaggtgctg
gcctccgcgatggggcggaacgaagtgcataatgtgcggctggtcaaaggcagccatatc
gtggtgccgaaggtttcagacgatccacgcgcctatttctttcagaaccgcgacggccgc
atcattttcgcaatcccatatgaggacgatttcacgctgatcggcacgaccgatcaggat
tatgacggcgagccgcgggacgcggcgatcagccctgccgagaccgactatctctgtgcg
gcggcgagcgagtatttcgccaggccggtacgtcgggaagatatcgtttggacctatgcc
gccgtccgcccgctcttcgacgacggcgcctccaaggcgcaggaagccacccgcgattac
gtgctgcgcgtggaggagggggacggcgatgccgcgctcgtcaacatcttcggcggcaag
atcaccacttaccggcgtctttccgaagccacgctggaaaaaatcgaagagttgctcggc
cgcaaaggacaggcctggacggccgatgcgcggctgccgggaggagatttcgcggtcgac
ggtttcgatgggcagatcgcaggactcctgcgcgactacccgtttctcaatgccggtcac
gcgcgccggctggtgcgccgctatggcacgcgggcacgcgcaattctcgggcaggcgcgg
tcgaccgacgatctgggggttcatttcggggctgacctctatgaggcggaggtccggtat
ctgatggagcaggagtgggcacgcacggccgaggacgtactctggcgccgcacgaaacgt
ggcctgcgccttgcgccgaatgaggtcgtgaccctggaggaattcatggaggatctcgcc
agccgcagacggcacgaggcagccgagtag

DBGET integrated database retrieval system