KEGG   Chelativorans sp. BNC1: Meso_3572
Entry
Meso_3572         CDS       T00374                                 

Definition
(GenBank) periplasmic sensor signal transduction histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mes00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Meso_3572
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mes01001]
    Meso_3572
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mes02022]
    Meso_3572
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Meso_3572
Protein kinases [BR:mes01001]
 Histidine kinases
  OmpR family
   Meso_3572
Two-component system [BR:mes02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   Meso_3572
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3 DUF2730 RHH_8 ABC_trans_N
Other DBs
NCBI-ProteinID: ABG64941
UniProt: Q11CD4
LinkDB
Position
3844581..3846350
AA seq 589 aa
MAIEVQDKVGSAGPAEAGRSSSWSPGRFAVPIRRLLGHFMFSSLTRRILTLNLTAIGVLV
IGVLYINQFRDALVEAQIESLRTQGRIIAGAIAASAAVETDAILINPEKLLEMQAGEELP
PGSDQLENLEFPINPEKVALLLRRLINPDKTRARIYDRDAALVLDSRQLYSILRYRLPAV
DGEEKSFLEKIEERISSIFQANDLPIDREQPGGSGVAYEEVMAALKGGEPEAVRRRSPEG
EYIISVAVPIQRYRAVVGVLQLSTQGDIDRIIAEERHAVLRVFGVAALVTAILSLLLAST
IANPLRRLAAAAIRVRRGTNTREEIPDFSHRQDEIGNLSIALRDMTKALYARIEAIESFA
ADVAHELKNPLTSLGSAVETLPLAKDERSRERLMEIIQHDVRRLDRLITDISDASRLDAE
FAREDSEIIDLQKFLRDLVAGAQDAGSKKKKVDIQFKTEGKAGQSFVVQGHDLRLGQVVT
NLIENARSFVPDEGGRVTITLSRSQRRIIITVDDNGPGIRADNIDRIFERFYTDRPAGEA
FGQNSGLGLSISRQIVEAHGGTLTAENIPGAKPGEVRGARFVISLPAEG
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggccatagaggtacaagataaggtcggatcggcggggccggcagaggcagggcgttcc
agttcatggtcgccaggccgatttgccgtgcccattcgccggctgctggggcacttcatg
ttctccagcctcacgcggcgcattcttaccctcaacctcaccgccatcggcgtgctcgtc
atcggggtcctctatatcaatcagtttcgagatgcgctggtagaggcgcagatcgaaagc
ctcaggactcagggacgcatcatcgccggcgctatcgctgcctccgcggcggtggagacc
gacgcgatcctgatcaatccggaaaaattgctcgaaatgcaggctggcgaggagttgcct
cccggatcggaccagctggaaaatttggaattcccgatcaatccggaaaaggttgctctt
cttttgcggcgcctgatcaacccggacaagacacgagcgcgcatttacgaccgggacgcc
gcgctggtgctcgattcgcgccagctctactccattcttcgttaccggcttccggccgtt
gacggcgaggaaaagagcttccttgagaaaatcgaggagcggatcagctccattttccag
gcaaatgacctgccgatcgaccgcgagcagcctggtggcagcggtgtggcctatgaggag
gtgatggcggccctgaaaggaggcgaaccggaagcggtgcgccgccggagcccggagggc
gaatacatcatttccgttgccgtgcccatccagcgttaccgcgccgtggtgggcgtgctc
cagttgtcgacgcagggcgacatcgatcgcattattgctgaagaacggcatgctgttctg
cgtgtctttggagtggctgcgctggtgaccgcaatcctgtcgctgctgcttgcctcaacg
attgccaatcccttgcggcggctcgcggcggctgccatacgcgttcgccgcggcaccaac
actcgcgaagaaattcctgatttctcgcaccggcaggatgagatcggaaatctctcgatc
gccctgcgcgacatgaccaaggcgctttatgctcgcatcgaggccatagagagcttcgcc
gctgacgtggcgcatgagctgaaaaatccgctcacttcgctgggaagcgcggttgaaacc
ctgccgctcgccaaggatgagcgctcacgcgagcggctgatggagatcattcagcatgac
gtgcgccgactggacaggctgatcaccgatatctccgacgcctcgcgcctggacgcggaa
ttcgcgcgcgaggattcggagatcatcgatttgcagaaatttctgcgcgatctcgtcgca
ggcgcgcaggacgcgggcagcaagaagaaaaaggtcgatatccaattcaagaccgaaggc
aaggcgggccagagctttgtcgtgcaggggcatgacctccggctcggccaggtggtcacc
aatctcatcgagaacgcacgctccttcgtgccggatgagggcgggcgcgtcaccatcacg
ctctcgcgcagccagcggcgcatcatcattacggtcgatgacaacgggccgggcattcgc
gccgacaatatcgaccgcatctttgagcgcttctacacggaccggccggcgggcgaggcc
tttggccagaattcgggcctgggcttgtccatcagtcgccaaatcgtggaagcgcatggc
ggcacgctgaccgcggagaacatcccgggcgccaagcccggcgaggtgcggggtgcacgc
ttcgtgatctcgctgcccgcggaaggctga

DBGET integrated database retrieval system