KEGG   Manihot esculenta (cassava): 110599973Help
Entry
110599973         CDS       T05761                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00010  Glycolysis / Gluconeogenesis
mesc00020  Citrate cycle (TCA cycle)
mesc00620  Pyruvate metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
mesc01200  Carbon metabolism
Module
mesc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110599973
   00020 Citrate cycle (TCA cycle)
    110599973
   00620 Pyruvate metabolism
    110599973
Enzymes [BR:mesc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110599973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 110599973
NCBI-ProteinID: XP_021592316
LinkDB All DBs
Position
LG14
AA seq 418 aa AA seqDB search
MTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGESAPVGAPI
GILAETEDEIAEAKAKAASKTGSTGSSAVAAPPPTATSAPTSAISQLVPAPAIPAAAGDG
SRKIVATPYAKKLAKQHKVDIDKVTGTGPFGRITPADVEAAAGITPTKPVATKPAPVAAA
APAKPATTLSAPPLPGSTVVPFTTMQAAVSKNMVDSLSVPTFRVGYPVTTDALDALYEKV
KPKGVTMTALLAKAAAMALVQHPVVNASCKDGKSFTYNSNINVAVAVAINGGLITPVLQD
ADKLDLYLLSQKWKELVEKARTKQLQPHDYNSGTFTLSNLGMFGVDRFDAILPPGQGAIM
AVGASKPTVVADADGFFSVKNKMLVNVTADHRIVYGADLAAFLQTFAKIVENPESLTL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactgagggcaagattgtttcctggattaaatcagaaggtgacgtcctatccaaaggt
gaaagcgttgtcgttgttgagtccgataaggctgacatggatgttgagaccttctatgac
ggcattctcgctgcaattgttgtgcctgagggtgaaagtgctccagtcggcgctcctatt
ggaattttagctgagaccgaggacgaaattgctgaagcgaaagcaaaagccgcgtcgaaa
acgggtagtactggttcatcagctgttgctgcccctcctcctactgctacttctgctcct
acttctgcaatttcgcaactggtacctgctcccgcgatacctgctgctgctggggacggg
tcaaggaagatagtggcgacgccgtatgcaaagaaattggcgaagcagcataaggtggat
atcgacaaggttactggaacggggccgttcggcaggataacgccggctgacgtggaggca
gcggcgggtattactcctaccaaacctgtggctacgaagcctgctccagtagcggctgct
gctcctgctaaacctgctactactctatcagctcctccacttccagggtctacggttgta
ccgtttactacaatgcaagcggcggtgtcgaaaaatatggtggacagcctttcagtaccc
acttttcgagttggatatccagtgacaactgatgcacttgatgcactatatgagaaggtt
aaaccaaaaggtgtgacaatgacggcattattggcaaaagctgcagcaatggcacttgtt
cagcacccggtcgtgaatgccagctgcaaggatgggaaaagtttcacctataacagtaac
attaacgttgcagtggcagtagcaatcaatggtggattaattacccctgttcttcaagat
gcagataagttggatctgtacttactatcacaaaagtggaaagaattggtggagaaagcc
agaacgaagcaacttcagccccacgattataattcagggacattcactctatccaatttg
ggaatgtttggagttgacaggtttgatgctattcttcctcctggtcagggggctataatg
gctgttggagcatcaaaaccaactgtggtggctgatgcagatggattctttagtgtgaaa
aataaaatgctggtgaatgtaacagctgaccaccgaattgtctatggtgccgacttggct
gccttccttcaaactttcgcaaagattgttgagaacccagaaagcctgacattataa

DBGET integrated database retrieval system