KEGG   Manihot esculenta (cassava): 110601213Help
Entry
110601213         CDS       T05761                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00020  Citrate cycle (TCA cycle)
mesc00190  Oxidative phosphorylation
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
mesc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110601213
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110601213
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110601213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110601213
NCBI-ProteinID: XP_021593964
LinkDB All DBs
Position
LG1
AA seq 633 aa AA seqDB search
MWRFVARGLRLPSSSKSISNDSLRSHISRFFSTESTGGRSSYTIVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAAST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTVKGNDPDAV
VPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGGKQKPLEKDAGER
TIAWLDKLRNSNGSLPTSQIRLNMQRVMQTNAAVFRTQETLEEGCQLIDKAWESFDDVKL
KDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDANWMKHTLG
YWEKEKVRLEYRPVHMNTLDDEIESFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtttcgtagctcgtggccttcgtcttccctcttctagcaaatccatctctaat
gactcccttagatctcacatttccagatttttctctacggaatcgactggggggcgatcc
tcatacaccattgttgatcatacatatgatgcagtggttgtaggagcaggtggtgcaggg
ttgagagctgccataggactctcagaacatggattcaacactgcttgcattaccaagctt
tttccaactcgttcacacactgttgcagctcagggaggaatcaatgcagctttgggaaat
atgactgaagatgattggaggtggcacatgtatgacactgtcaagggaagtgactggtta
ggtgatcaggatgccattcaatacatgtgtagagaagcaccaaaggcagttattgaactt
gagaactatgggctaccattttcccgaacagaagatggacgaatttatcagcgtgcattt
ggtggtcagagtttaaattttggaaaaggtggacaagcatatcgttgtgcatgtgctgct
gaccgaactgggcatgctcttttgcatactctctatggccaagctatgaaacataatacc
caattttttgtggaatattttgctttggatctattaatgaacagtgatggtagctgccaa
ggagtaattgcattgaatatggaggatggaacattacatagattccgagctgcttcaact
attcttgccacagggggctatggtagagcatacttttcggcaacatcagctcatacatgc
actggagatggcaatgctatggttgcacgcgccgggcttccactccaggacctggaattt
gttcagtttcatcctacaggcatatatggagctggctgcctaattactgaaggatctcgt
ggagaaggtggtattcttaggaacagtgaaggtgaaagatttatggaaagatatgctcct
acagccaaggatcttgcatcaagagatgttgtttcaagatctatgacaatggagattcgg
gagggtcgtggtgttggacctttgaaggaccatatctatttgcatttaaatcacttgccc
ccagatgtactaaaggagaggcttccaggtatttctgaaactgccgccattttcgcaggt
gtggatgttacaaaggaacccatccctgtcttacccaccgtgcattacaatatgggtgga
attcccacaaattaccatggagaggtagttaccgttaaaggcaatgatcctgatgcagta
gttccgggattaatggcagctggagaggcagcctgtgcgtcagtgcatggtgccaatcgg
cttggtgcaaattctctgcttgacattgttgtttttggtcgagcttgtgcaaatagagtg
gcagagatccagagaccagggggaaaacagaagcctttggaaaaggatgctggagaaagg
accattgcatggctggacaaactgaggaattcaaatggatccctgccaacttcacaaatt
cggttaaacatgcagagagtaatgcaaactaatgctgctgtattccgtacacaagaaaca
ttggaagaaggttgtcagctgattgacaaggcatgggagagctttgatgatgttaagttg
aaagatcgcagtttaatatggaactccgacttgatagaaaccatagaattggagaacctt
ttgataaatgcctgcataacaatgcactctgctgaggctcggaaggaaagcagaggagca
catgcccgtgaagacttcactaaaagagatgacgctaactggatgaagcacactttggga
tattgggagaaagaaaaagttcgtctcgaatacaggccagtacacatgaatacattagac
gatgagattgagtcattcccacctaaagctcgtgtctattga

DBGET integrated database retrieval system