KEGG   Manihot esculenta (cassava): 110603692Help
Entry
110603692         CDS       T05761                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like isoform X1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00071  Fatty acid degradation
mesc00592  alpha-Linolenic acid metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
mesc01212  Fatty acid metabolism
Module
mesc_M00087  beta-Oxidation
mesc_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110603692
   00592 alpha-Linolenic acid metabolism
    110603692
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110603692
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110603692
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110603692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 110603692
NCBI-ProteinID: XP_021597222
LinkDB All DBs
Position
LG16
AA seq 721 aa AA seqDB search
MAKPHVTLEVGNDGVAVISMCNPPVNALAIPIIAGLKEKFDEATRRNDVQAIVLTGKYGK
FSGGFDINVMQKVHQTGDVSLVPDVSVDLVVNTIEDCKKPVVAAVEGLALGGGLELAMGC
HARVVAPKTQLGLPELTLGIIPGFGGTQRLPRLVGLSKAIEMMLSSKPITSEEGKKLGLV
DIIVSSQELLKVSRQWALDIKERHKPWMRSLYRTDKICSLSEARQILKAARQQAKKTAPN
MPQHQACLDVIEEGVVHGGYNGVLKEAKVFKELVISDTSKGLIHVFFAQRATSKVPNVTD
IGLKTRQIKKVAVIGGGLMGSGIATALIVSNIYVVLKEINSEYLLKGIKMIEANVRGLVT
RGKLTQDKRDKALSMLKGVLDYSEFRDVDMVIEAVIESIPLKQKIFSEIEKACPTHCILA
TNTSTIDLNIIGEKTSARDRIIGAHFFSPAHIMPLLEIVRTEKTSAQVILDLLTVGKSIK
KVPVVVGNCTGFAVNRTFFPYSQGAHILVNLGVDVFRIDRLISTFGLPMGPFQLQDLTGY
GVAVAVGKEFANAFPDRTFLSPLVRLLVESGRNGKNNGKGYYIYEKGSKPKPDPSVIPII
EESRRVTNIMPNGKPINVTDQEIVEMILFPVVNEACRVLDEGVVVRASDLDIASVLGMSF
PSYRGGIVFWADTVGPKHIYTSLKKWSQLYGNFYKPSRYLEERASKGMLLSAPASSSRSR
M
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcctcatgtcaccttggaggtcggaaacgacggcgttgctgtcatctccatg
tgcaatcctcccgttaatgccttggccattccaattattgccggactgaaggagaaattc
gatgaggccacaaggagaaacgacgttcaagctatcgtattgactggcaagtatgggaaa
ttttccggtggttttgatatcaatgtcatgcagaaggtccaccaaactggcgatgtgtca
cttgtccctgatgtatctgttgaccttgtggtcaacacaattgaagattgcaagaagcct
gttgttgcggctgtggaaggactagcactgggaggtggcttagaactagcaatgggatgt
catgcacgtgtagttgcacctaaaactcaacttggcttgccggagttgacacttggaata
attcctgggtttggaggtacacaacgtcttccaaggcttgtaggactgtcaaaagccatt
gaaatgatgctgtcatccaaaccaatcacatctgaagaagggaagaagcttggtcttgtt
gatattattgtgtcttctcaagaactgctgaaagtatctcggcaatgggctttagacatc
aaagagaggcacaaaccatggatgcgttctctttacaggacagacaagatttgctccctg
tctgaagcacgccagatattgaaagctgccagacaacaggccaagaagactgccccaaat
atgcctcagcatcaggcatgccttgatgtgattgaggaaggtgttgttcatggaggatat
aatggagtcctaaaggaagcaaaagtattcaaggagttagtcatatcagatacatctaaa
ggtcttattcatgtcttttttgctcagcgtgcaacatcaaaggtacctaatgttactgat
attgggctcaaaaccaggcaaataaagaaggttgctgtcattggtggaggtctgatgggt
tctggcatcgctactgctcttattgtgagcaacatatatgttgtactgaaagaaataaac
tctgaatatcttctgaaaggaataaagatgatagaagcaaatgttcgaggcctagttaca
agaggtaagttaacacaggataagagagacaaagcactttcaatgctcaaaggtgtattg
gactactcagagtttagagatgttgatatggtcatagaggctgttattgaaagtattcct
ctgaagcaaaaaatttttagtgaaattgagaaggcctgtcctactcactgcatcttggca
acaaatacatctactattgacctcaatataattggagaaaagaccagcgctcgagatcgt
attataggtgcacactttttcagtcctgctcatataatgcctcttctggagattgtacgc
acagagaagacttctgcacaagtaattcttgatctcttgacggttggaaaatctataaag
aaagttcctgttgtggtgggtaactgcactggctttgcagtcaaccgcactttctttccc
tattcgcaaggtgcacatattctggtcaatttaggtgttgatgtgttcagaattgacagg
ttgatcagcacttttggcctacctatgggtcctttccagcttcaggatttaactggatat
ggagttgctgtagcagtgggtaaagaatttgctaatgcattccctgatcgtacattcttg
tctccattagttagacttttagttgaaagtggacgaaatggtaaaaacaatgggaaagga
tattacatttatgagaagggaagcaaaccaaaacctgatccttcagtgataccaatcatt
gaggagtctaggcgggttaccaatattatgcctaacggaaagcctataaatgtcaccgac
caagagatagtggagatgatactctttccagtagtaaatgaagcatgtcgtgttctggat
gagggcgtggtagttcgagcatcagatcttgacattgcatctgtgctaggcatgagcttc
ccatcctatcgtggtggcattgttttttgggcagacacagttggacctaaacacatatat
acgagtctgaagaaatggtcccaattatacggtaacttctacaaaccatcaagatatttg
gaagaaagggcatcaaaaggcatgctgttgagtgcccctgcttcatcgtccagatctcgc
atgtag

DBGET integrated database retrieval system