KEGG   Manihot esculenta (cassava): 110603877Help
Entry
110603877         CDS       T05761                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00010  Glycolysis / Gluconeogenesis
mesc00051  Fructose and mannose metabolism
mesc00052  Galactose metabolism
mesc00500  Starch and sucrose metabolism
mesc00520  Amino sugar and nucleotide sugar metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
mesc01200  Carbon metabolism
Module
mesc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mesc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110603877
   00051 Fructose and mannose metabolism
    110603877
   00052 Galactose metabolism
    110603877
   00500 Starch and sucrose metabolism
    110603877
   00520 Amino sugar and nucleotide sugar metabolism
    110603877
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110603877
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mesc04131]
    110603877
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110603877
Membrane trafficking [BR:mesc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110603877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110603877
NCBI-ProteinID: XP_021597555
LinkDB All DBs
Position
LG16
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMRCSGRWARAMAILREFEDKCGTPLGKLRQVAD
AMTVEMHAGLASEGGSKLKMLLSYVDNLPTGDEKGLFYALDLGGTNFRVIRVVLGGKDDR
VVKQEFEEVSIPPHLMIGSSDALFDYIAEALAKFVATEDEGLHPLPGQQRELGFTFSFPV
RQTSIASGTLIKWTKGFSIEDTVGEDVVGELTKAMERVGLDMRVAALVNDTIGTLAGGRY
YNKDVIAAVILGTGTNAAYVERAQAIPKWNGLLPKSGEMVINMEWGNFRSSHLPLTEFDQ
ALDVESLNPGEQIFEKLISGMYLGEIVRRVLLRMAQEAAFFGDVVPPKLEIPFILRTPHM
SAMHHDTSSDLKVVGSKLKDILEISNTSLKMRKAIVELCDIVATRGARLSAAGIMGILKK
LGRDTVKDGEKQKSVIALDGGLFEHYTKFRSSMESTLKELLGEEISESIIIEHSNDGSGI
GAALLAASHSQYLEVAEA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggtggcggtgggtgcggcggtggtctgcgcagctgctgtttgtgctgcggcg
gccttggtggtcaggcacaggatgcgctgttcggggaggtgggccagggctatggccata
ctcagggagtttgaggacaagtgtgggacccccttagggaagctacgccaggtggctgat
gctatgaccgttgagatgcatgccggtcttgcatcggagggtggaagcaagcttaagatg
ctcctcagctacgttgacaatctccctaccggggatgagaagggattgttttatgcatta
gaccttggtggcacaaatttccgtgtcataagggtggtattgggcgggaaagatgaccgt
gttgtcaaacaagaattcgaggaagtttcaattcctccacacttgatgattggatcttca
gatgctctgttcgattatattgctgaagcacttgctaaatttgttgctacagaagatgaa
ggtttgcatcctttgcctggtcaacaaagggaactgggatttaccttctcatttcctgtt
cggcaaacatcaatagcatcaggaactcttataaaatggacaaaaggcttctccatagag
gatacggttggggaggatgtggtgggagagttgacaaaagccatggaaagagttggcctt
gacatgcgtgtggcagctttggtcaatgatacaattggaacattagctggagggagatac
tacaacaaggacgttattgctgctgtaatcttgggaactggaacaaatgcagcatatgta
gagcgagcacaagcaattcccaagtggaatggtcttcttcctaaatctggggaaatggtt
atcaacatggagtggggtaactttcggtcctcacaccttccattgacagaatttgatcaa
gcattagatgttgagtctctgaaccctggggaacagatttttgaaaagttaatttctggt
atgtatttgggagaaattgtacgcagagttctattgagaatggctcaggaagctgccttc
tttggtgatgttgttccaccaaaactggagattccatttatcttaaggacaccacacatg
tctgcaatgcatcatgatacatcttcagatcttaaagttgttggaagcaaattaaaggat
atcctagagatatcaaatacctccctgaaaatgaggaaagctattgttgagctctgcgac
attgttgccactcgcggtgcccggctgtctgctgctggaatcatgggcatcctcaagaaa
ctgggaagagacacagtgaaggatggggaaaaacagaaatcagtaatagcattagatggt
gggctgtttgagcactacactaaattccgtagctccatggagagcactctcaaggaattg
ctgggagaggaaatttctgaaagcataatcattgagcactcaaatgatggctcaggcatt
ggagcggctctccttgcagcttcccactcccagtacctggaggtcgcagaagcttaa

DBGET integrated database retrieval system