KEGG   Manihot esculenta (cassava): 110604540Help
Entry
110604540         CDS       T05761                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00250  Alanine, aspartate and glutamate metabolism
mesc00410  beta-Alanine metabolism
mesc00430  Taurine and hypotaurine metabolism
mesc00650  Butanoate metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Module
mesc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110604540
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110604540
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110604540
   00430 Taurine and hypotaurine metabolism
    110604540
Enzymes [BR:mesc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110604540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 110604540
NCBI-ProteinID: XP_021598436
LinkDB All DBs
Position
LG17
AA seq 497 aa AA seqDB search
MVLSKIASQSDVSVHSTFASRYVRESLPRYKMAENSIPKEAAFQIINDELMLDGKPRLNL
ASFVTTWMEPECDKLMMDAMNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKVTGWDTP
IHVDAASGGFIAPFLWPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGYEGYRNVMENCHQNAQVLKQGLEE
TGRFNIVSKDIGVPLVAFSLKDNSQHNEFEIAETLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVLDIVKVLNELDSLPAKINAKMAVVAEQKNGKLIKKTAIETQREITT
YWKNFVMANKNNKNTIC
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcaaaaatagcttcacagtctgatgtctccgtccactccaccttcgcctct
cgctatgtccgggagtcgcttccaaggtacaagatggcggagaactccatacccaaggag
gctgcattccagatcataaacgacgagctgatgctggatgggaagccgagattaaacttg
gcttcctttgtgactacttggatggagcctgaatgtgataagcttatgatggacgctatg
aacaagaactatgttgatatggatgagtacccagtcaccactgagcttcagaatcggtgt
gtgaacatgatagcacatctgttcaatgctccgctgggagactcagaggcggcagtgggc
gtcggaacggtgggatcttcagaggcgataatgcttgcaggacttgccttcaagagaaag
tggcagaacaagcgcaaggctgaaggaaaaccatatgacaagcccaacattgtcactggt
gcaaatgttcaggtctgctgggagaaatttgccaggtacttcgaggttgagctcaaggag
gtgaagctaagggaaggctactacgtgatggaccctgaaaaagctgtggaaatggtggat
gagaacactatctgtgtagctgccatcttgggttccaccctcaatggcgaattcgaagac
gttaagcttctgaatgatctgttggtagagaagaacaaagtcactgggtgggatactccc
attcatgtggatgcagctagtggtggattcattgcaccattcttgtggccagaacttgaa
tgggacttcaggcttccattggtgaagagcatcaacgttagcggccacaaatacgggctt
gtctatgccggagttgggtgggtcatatggaggagcaaagaagatttgcctgaagagctc
atcttccacattaactaccttggaactgatcaacccactttcactctcaatttctccaaa
ggttctagccaaatcattgctcagtactatcaactgatccgcctgggctacgagggatac
cgaaacgtgatggagaattgtcaccaaaacgctcaagtcctgaaacagggactagaggaa
acaggacgattcaacattgtttcaaaggacattggagttcctctggtggcattttcactc
aaggacaatagccaacacaatgaatttgagatagctgaaacgctacggcgttttgggtgg
attgttcctgcctacactatgccggcggatgctcagcatgtgacggtgctccgagtggtt
atcagagaagatttctcaaggactctggcggagcgccttgtgcttgatattgtaaaggtg
cttaatgagctggattcgctgccggcgaaaatcaatgctaaaatggcagtagtagctgaa
cagaagaatggtaagctgataaagaaaactgcgattgagacccagagggaaatcaccacc
tactggaaaaattttgtcatggccaataagaataacaagaacactatctgctaa

DBGET integrated database retrieval system