KEGG   Manihot esculenta (cassava): 110604547Help
Entry
110604547         CDS       T05761                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc03030  DNA replication
mesc03410  Base excision repair
mesc03420  Nucleotide excision repair
mesc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110604547
   03410 Base excision repair
    110604547
   03420 Nucleotide excision repair
    110604547
   03430 Mismatch repair
    110604547
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mesc03032]
    110604547
   03400 DNA repair and recombination proteins [BR:mesc03400]
    110604547
Enzymes [BR:mesc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110604547
    6.5.1.6  DNA ligase (ATP or NAD+)
     110604547
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110604547
DNA replication proteins [BR:mesc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110604547
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110604547
DNA repair and recombination proteins [BR:mesc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110604547
   NER (nucleotide excision repair)
    Other NER factors
     110604547
   MMR (mismatch excision repair)
    Other MMR factors
     110604547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 110604547
NCBI-ProteinID: XP_021598452
LinkDB All DBs
Position
LG2
AA seq 1405 aa AA seqDB search
MEACKSTDKPPEALDSLRLYHNSLASLSLRIPPHDQPSSLPLPSSLPLSKLIPGTRFLVD
AFRFSTSSSITYFLSHFHSDHYTGLSSNWSQGLIFCSPTTANLLIQVLKIPSQFVFPLPL
LEPVIIDGSQVTLVDANHCPGAVQFLFKVPGKDQEGFEMYIHTGDFRYHSSMKEDGLISQ
FVGCDAIFLDTTYCNPKFLFPSQQESIDHIVSVIKRIRGDFMIQEKSVLFLVATYVVGKE
RILLEIAQRCKRKVHVDGRKMEVLRVLGHGESGVFTEDENESDVHVVGWNVLGETWPYFR
PNFVRMKEIMVERGYSKVVGFVPTGWTYEVKRHKFSVRSKDSCEIHLVPYSEHSNYDELR
EYVKFLRPKRVIPTVGVDIEKFNSKHTIKIQKHFAGLVDEMANKKEFLMAFHHGSCENDE
KAGLEDVVELNERMDPEEDGNLSEVKALEDKDPGVVLNSSSTLQEHGSQNLTILNDDETE
KIIRELSDSLPSWVTRDQMLDLIQSSGGNFVDTVSNFYEHETEFHQQIFPCRTSMCSSQT
DSLNESESLSNQVSIKNSQETSGTTPLSQNYKSSNLKPSSKSGMTLGKRKRSVGKKAKTN
SKLESGGPRQSTITRFFNKLVPDVSQGSEVQFLPGQSMEENSLQNDDTNSYKEEIYQFIQ
IIGGNESSRGYAAVIMERTKGDINKALDVHYGNEGNFDQSVEKLVASDNLVQPQCNIHEC
SSAQDKTVSEEGKHMVDLSIQRSLKENVAATYVSLPPEKYNPIQHACWSIGEPAPYIHLA
QTFDLVEAEKGKIKATSMLCNMFRSLLALSPEDLLPAVYLCTNKIAADHENIELNIGGGL
VTSSLEEACGTNRSKLRDMYNSMGDLGDVAQMCRQKQTLLAPPSHLLIKDVFSVLQKISV
QTGTGSTLRKKRLIVNLMRSCREKEMKFIVRTLVRNLRIGAMMRTILPALAQAVAMNSLV
NFDEQKAESLKEKLQYLSSAVVEAYNILPDLGLIVPSLISKGIEFSSSTLSMVPGVPIKP
MLAKITNGVSQAVKLFQDKAFTCEYKYDGQRAQIHKLPNDTFRVFSRNGDETTSRFPDLI
NIMKESCKSAAVTFIVDAEVVAIDRKNGCKLMSFQELSSRERGSKDSFITVNNIKVDICV
FVFDIMFANGEQLLELPLRQRRKRLKDLFCDERMGYFEYAKEMTVETHDSCLTNDVTMAK
INSFLEEAWHSSCEGIMVKSLDVHAEYSPSKRTDTWLKVKRDYVEGLNDSLDLVPIGAWH
GNGRKAGWYSPFLMACYNPETEDFQSVCRVMSGFSDVFYTEMKAFFSEDRILLKKPSYYQ
TSEVPDLWFSPELVWAIRGADLTVSPVHHAAIGLVHPSRGISMRFPRFVRPVSDRNPEEC
STAADIAEMFNSQTRKMNVTGTAAK
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctgcaaatccaccgacaaaccacccgaagccctagactctctccgtctttac
cacaactctcttgcttccctctccctccgaatccctccacatgaccaaccctcctcgctc
cctctcccctcctctctcccactgtccaagctcatccccggaactcgcttcctcgtcgac
gctttccgcttctccacctcctcctccatcacctactttctttcccatttccactctgac
cactacaccggcctttcttctaattggtctcagggcctcattttctgctcccccacaaca
gccaatctcctcatccaagtcctcaagattccctcgcagttcgtcttcccattgcctctg
ctcgagcccgtgattattgatggttctcaagttacattagttgatgctaatcactgcccg
ggggcggtgcagttcttgtttaaggttcctggtaaggatcaagaagggtttgaaatgtat
attcatactggtgattttagataccatagttcgatgaaagaggatggcttaattagtcag
tttgttggttgtgatgcgattttcttggatactacttattgtaatcctaaattccttttt
ccctcgcaacaggagtctatcgatcatatagttagtgttataaagagaataaggggagat
tttatgattcaagaaaagagcgtgttgtttcttgtcgcgacttatgtggttgggaaggag
aggattttgcttgagattgcgcaaaggtgtaaaagaaaggtgcatgtagatgggaggaag
atggaggttttgcgggttttgggacacggggaaagtggggtgtttacagaggatgagaat
gaaagtgatgttcatgttgttgggtggaacgtgttaggagagacatggccatactttcgg
ccaaattttgttagaatgaaggaaataatggtggaaagaggatattctaaggttgttgga
tttgtcccaactggatggacttatgaagtgaagcgtcataaattctctgtcaggtcaaag
gattcatgtgagatccatcttgtgccatacagtgagcattcaaattatgatgagcttaga
gagtatgtgaagttcttgagacctaagcgtgtcattcctacagttggcgtggatattgaa
aaattcaacagtaaacacactattaaaattcagaagcattttgctggtttagttgacgaa
atggctaacaagaaagagtttttgatggcttttcatcatggatcatgtgagaatgatgaa
aaggctggattggaagatgtggtagagttgaacgagcgcatggatccagaggaagatggg
aatttatctgaagtgaaagcccttgaagataaggatccaggtgttgttttgaactcttca
tctactctgcaagaacatggttcacaaaatttaactatactaaatgatgacgaaacagaa
aaaataatacgagaacttagcgattctttgccctcgtgggttactcgagaccaaatgtta
gatttgattcaaagctcaggagggaattttgttgatacagtttcaaacttttatgaacac
gaaacagaatttcatcaacaaatctttccttgtaggacatccatgtgttcttctcagact
gattctctcaacgaatctgaatcactttcaaatcaagtttctatcaagaatagccaagag
acttcagggacgactcctttgagtcaaaattataagtcatcaaacttaaagccttcaagc
aaaagtggtatgactcttggaaaaaggaagaggagtgttggcaagaaggcaaaaacgaac
tcaaaattggaatctggtggaccaaggcagtctactattacaaggttctttaataaactc
gttcctgatgtttctcaaggtagtgaggtccaattcttacctggtcaatctatggaagaa
aattcattgcagaatgatgatacaaactcatacaaagaggagatatatcagtttattcag
ataattggcggtaatgaatcatcaagaggctatgctgccgttatcatggagaggaccaaa
ggagacattaataaggcattagatgtgcattatggtaatgaaggtaactttgatcagagt
gtagagaaattggttgcatcagacaatttggttcagcctcagtgcaatattcatgagtgc
tcttctgcccaggacaaaactgtatcagaggagggaaagcatatggttgatctgtccata
cagagatcattgaaagaaaatgtcgctgctacttatgtttcactaccaccagaaaaatac
aatcccatacaacatgcatgctggagtattggagagcctgctccctatatccatcttgca
caaacatttgacctagttgaggcggaaaagggaaagatcaaggctacttccatgttgtgc
aatatgtttagaagtttgctagcgttgtctcctgaggatttgctacctgctgtgtatctg
tgcacaaacaagattgctgctgaccatgaaaatatagagctcaacattggtggaggcttg
gtcacttcgtcgctagaagaggcatgtgggacaaaccggtctaaactaagggatatgtac
aatagtatgggggatcttggtgatgttgctcaaatgtgccgacaaaaacagacattactt
gctcctccttctcaccttctcataaaagatgtattttctgttctccaaaagataagtgtg
caaacaggtactggaagcactcttcgaaagaagaggctcattgtaaatctcatgcgttct
tgcagggagaaggagatgaagtttattgttagaactttggtaagaaacttacggattgga
gctatgatgagaactattctacctgcattggctcaagctgttgctatgaattccttggtc
aatttcgatgaacaaaaagctgaaagtttgaaggagaaacttcagtacctttcctcagca
gtcgtagaagcatataatatacttccagatttgggtttgatcgttccctcactcataagc
aaaggcattgaattttcatcatcaactttgtctatggtgccaggagtacctattaaaccg
atgctggcaaaaattacaaatggagtttcccaagcagttaaactctttcaagataaagct
tttacatgtgaatacaaatatgatggtcagcgtgcccaaattcacaaattaccaaatgac
acttttcgtgtattttcacggaatggggatgaaacaacatcaagatttccagatttgatc
aatataatgaaggaatcttgtaaatctgctgcagtaactttcatagtggatgcagaggtg
gttgcaattgatagaaaaaatggctgcaagctcatgtcattccaggaactatcatcaagg
gagagagggagcaaagattcctttatcacagtgaataatataaaggttgatatttgtgta
tttgtctttgatatcatgtttgctaatggagaacagctgctggagcttcctcttcgccaa
agaaggaaacgcctaaaggatttgttttgtgatgagaggatgggctattttgagtacgca
aaggaaatgacggttgaaactcatgattcttgtttgaccaatgatgtaacaatggccaag
ataaactctttccttgaagaagcatggcattcctcatgtgaaggaattatggtgaaatct
ttagatgttcatgctgaatattctccctcaaaacgtacagacacatggctaaaggtcaag
cgagattatgtagaaggattgaatgactcacttgatttagtccccattggtgcttggcat
ggtaatgggagaaaagcaggatggtatagtccatttctcatggcatgttacaaccctgag
actgaggacttccagagtgtttgccgtgtcatgtctgggttctcagatgtattttacact
gagatgaaagcattcttttctgaagatagaatattgttgaaaaagccgtcctactaccaa
acttcggaggtgccagatttgtggttttctccagaacttgtttgggcaatacgcggtgca
gacttgactgtttctccagttcaccatgctgctataggtttagttcatccatcccgtggc
atctccatgagatttccaagatttgttcgccctgtgtcagacagaaatccggaggaatgt
agcacagcggcagatattgcagaaatgtttaattctcaaacacggaagatgaatgtaaca
ggcacagctgccaagtaa

DBGET integrated database retrieval system