KEGG   Manihot esculenta (cassava): 110607793Help
Entry
110607793         CDS       T05761                                 

Definition
(RefSeq) protein SET DOMAIN GROUP 41 isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00310  Lysine degradation
mesc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110607793
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mesc03036]
    110607793
Enzymes [BR:mesc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     110607793
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     110607793
Chromosome and associated proteins [BR:mesc03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110607793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 110607793
NCBI-ProteinID: XP_021602648
LinkDB All DBs
Position
LG2
AA seq 710 aa AA seqDB search
MEDEMVNTEMQMRAGEDIGIGEDITPPLSPLSFSLHDSFIHSHCSSCFCPLPNRPSHSTT
IPHSLLYCSPLCSSFGSLLHFHSAEFHLLRCLSSTSPPPSSTSDLRAALRLLRLLPSHSS
QLGRTSGLLTNRHKLLADEQIVARIRCGARAMAIARRLRDGKQELIEVDENEYDAVLFEE
EEAALCLVLTNSVEVQDNDGRTLGIAVYDPTFSWINHSCSPNSCYRFLISPPSTAASPAD
SKLRIVPSCSNGEKSVYSNIEFRKGYGEYGPRMIVRSIKRIKRSEEVTVAYTDLLQPKAI
RRSELWSKYCFICCCKRCSASPPAYVDHILQLPLTGEGSKKVQDLLLLDVTSLSEVCREI
GSDNTTENKKGGGGNFREITASNHAPSRLSSDHSSSRDEANRKLTDYVDEIISEYLSVGD
PESCCEKLESILVLGLHDEPLETKEGKIQLNFRLHPLHHMALNAYITLASSYKIHANDML
ALCSEMNGHQLKPFHMSRAGAAYSFLLAAAAHHLFSFETSLIVSVANFWTSAGESLLTFA
RSSAWDLFGKQEITGLELLSHGNRKCSKCSFLDKFEANFSLSQNLNEDFENISSKFLDCI
SSYSREVWNFLSQGSHYLKMFKEPFDFSSSANMPKISDLEPTLCRKNMDSYCWSSSGLEE
AQQATNQERINILHLGVHCLLFGEYLASICYGTHSHYTRQVQRLVYCDDK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgaaatggtgaacacggagatgcagatgagagccggtgaggacataggaatc
ggcgaagacataacccctccactctctccactctccttctctctccacgactcttttatt
cactctcactgttcttcttgcttctgcccactccctaatcgcccttcacattccaccacc
attcctcactctctcctctactgttcccccctctgctcctccttcggctcccttctccac
ttccactccgccgaatttcacctccttcgttgcctttcgtccacatctcctcccccctca
tccacctccgacctccgcgctgctctccgccttctacgccttctcccttctcactcctcc
caacttggcaggacttccggattgttgaccaatcgccacaagttgctcgcagatgaacag
atagtcgcgagaattcgatgtggagccagggctatggcgatcgccaggagattgcgagat
ggaaaacaagaattgattgaggtggatgaaaatgaatatgacgctgtgttgtttgaggag
gaggaggccgctctgtgcttggtgctaacgaactctgtggaggtgcaggataatgatggc
cggactctggggattgctgtttatgatcctaccttctcctggattaatcacagctgttct
cccaattcttgttaccgattcttgatttctccaccgagtacagccgcatctccggcggac
tccaagttgcgaatagttcccagctgcagcaatggagagaagagtgtatatagcaatatt
gaatttagaaaaggatatggtgaatatgggccaaggatgatcgtgaggagcattaagagg
atcaagagaagcgaggaggtaacagtggcatacacagacttgttgcaacctaaggcaata
aggcggtcagagttgtggtcaaagtattgttttatttgttgttgtaaacgatgtagtgcc
tctccaccagcttatgtagatcatatattgcagttgccactcaccggtgaaggaagcaag
aaggtgcaggacttgttgctgttggatgtcacctctcttagtgaagtatgcagagaaatt
ggatccgacaacacaacagaaaataaaaaaggtggtggaggaaactttagggaaattact
gcttcaaatcatgccccttcaagattaagttctgatcacagttcttccagagatgaagca
aacagaaagctgacagattatgtagatgaaattatatccgagtatttatctgtaggtgat
cctgagtcttgctgtgagaaacttgagagcatactcgttcttggtctacatgatgagcca
ttggagaccaaagaaggaaaaatacagttgaattttaggttgcatcctctgcaccatatg
gcactgaatgcatacataacactggcttcttcatataaaatccatgcaaatgacatgctt
gctctctgttctgaaatgaatggacatcagttgaaacctttccacatgtccagggccggt
gcagcatactcctttctgcttgcagctgcagctcaccatctgttcagctttgaaacttca
cttattgtctctgttgcaaatttctggacaagcgcaggggaatccttgttaacttttgct
agaagctcggcatgggatttgtttgggaaacaggaaataactggcttggaacttctttct
catggtaatcgtaagtgctcaaagtgctcatttctggataaatttgaagccaatttttct
cttagtcaaaatctaaatgaagattttgagaacatatcaagcaaatttcttgattgtatc
tctagttattcacgtgaagtttggaattttctgagtcagggcagccattacttgaagatg
ttcaaagaaccattcgatttcagttcttcggcaaacatgccaaagatatcagaccttgag
cctactttatgcaggaaaaatatggattcctattgctggagcagttctggattagaggag
gcacagcaggccacaaaccaggaaaggataaatattttgcatcttggcgtccattgctta
ctttttggggaatatctagcaagcatatgttatggtacgcattcgcattataccagacag
gttcagagacttgtatattgtgacgacaaataa

DBGET integrated database retrieval system