KEGG   Manihot esculenta (cassava): 110609211Help
Entry
110609211         CDS       T05761                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00250  Alanine, aspartate and glutamate metabolism
mesc00410  beta-Alanine metabolism
mesc00430  Taurine and hypotaurine metabolism
mesc00650  Butanoate metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Module
mesc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110609211
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110609211
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110609211
   00430 Taurine and hypotaurine metabolism
    110609211
Enzymes [BR:mesc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110609211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Imm-NTF2
Motif
Other DBs
NCBI-GeneID: 110609211
NCBI-ProteinID: XP_021604330
LinkDB All DBs
Position
LG2
AA seq 496 aa AA seqDB search
MVLSKTTSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMEAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSEIAIG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPAKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKQTGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNVMENCRDNMLVLKEGLEK
TGRFNIVSKDNGVPLVAFSLKDNSCHTEFEISDMLRRFGWIVPAYTMPPDAEHVTVLRVV
IREDFSRSLAERLVIDIEKVLHELDTLPSRVSAKISITEEKQKNGTAKKSALETQREITT
IWRKFVTERKKMNGVC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaagacaacgtcggaatccgacgtctccgtccattccaccttcgcttcc
cgctatgtccgaacttcacttcctcggttcaagatgccagagaactcgatccccaaggaa
gcagcttaccagatcatcaacgatgagctgatgctggatgggaacccgagacttaatctc
gcgtctttcgtgaccacgtggatggaaccggagtgcgataagctcatgatggaggccatc
aacaagaactacgttgacatggatgagtacccggtcaccactgagttgcagaaccgatgt
gttaacatgatagctcatctattcaacgcaccacttggagattcagagattgcaattgga
gtaggaactgtgggttcctcagaagcaataatgttggctggattagcattcaagaggaag
tggcagaacaagagaaaagctgagggaaaaccttatgacaagcctaacattgttactgga
gccaatgttcaggtctgttgggagaaatttgcaaggtattttgaagtggagttgaaggaa
gtgaagctcagagaggggtattatgtgatggatccagcgaaagcagtggagatggttgat
gagaacacaatttgtgttgctgctatacttggctctactcttaatggggagtttgaagat
gtgaagcttttgaatgatctcttgatagagaaaaacaagcaaactggatgggatactcct
atccatgttgatgcagcaagtggtgggtttattgcccctttcatttatccagagcttgag
tgggatttcagattgccattggtgaagagtatcaatgttagtgggcacaaatatggattg
gtctatgctggaattggttgggtcatttggaggaacaaagaggatttgcctgaagaactc
atcttccatatcaactatcttggggccgatcaacctacatttacccttaatttctccaaa
ggttctagtcaagttattgctcaatactaccaactcattcgactgggttatgaggggtat
agaaatgttatggaaaattgcagagataatatgctggttttaaaggaaggactagagaaa
acagggcgtttcaatattgtctcaaaggacaatggggtgccattggtagctttctcctta
aaagacaacagctgccacactgagtttgaaatctccgacatgctaaggagatttggatgg
attgtgcctgcatatacaatgccacctgatgcagaacatgtaactgtgcttagagttgtc
atcagagaggacttctcccgttcgctcgcagaacgccttgttattgacatagaaaaagtt
ctgcacgagcttgataccttgccatccagagttagtgccaagatttcaataactgaagag
aaacaaaagaatggaactgctaagaagagtgccctggagacacagagggagattactaca
atttggaggaagttcgtcacagaaaggaagaagatgaatggtgtttgctaa

DBGET integrated database retrieval system