KEGG   Manihot esculenta (cassava): 110612716Help
Entry
110612716         CDS       T05761                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110612716
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110612716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110612716
NCBI-ProteinID: XP_021609177
LinkDB All DBs
Position
LG4
AA seq 226 aa AA seqDB search
MQASAVAAMAAHAVLAASLSSHPLLSPLPNLNPSNNPSLHSSFHGVSVKFPRQSLALSIA
AASPKKPLAVVAATKKAVAVLKGTSNVEGIVTLTQEDDGPTTVDVRVTGLTPGPHGFHLH
EYGDTTNGCISTGAHFNPNNMTHGAPEDEVRHAGDLGNIVANADGVAEVKIVDNQILLSG
PNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcatctgctgtagccgccatggcagctcacgcagttctggcagcttccctttct
tcacatcctctcctttcccctctcccaaatcttaatcctagtaataacccatctctccat
tcttcattccatggtgtctccgtcaagttccctcgccaatcgctagctctatctatcgcc
gcggcgtcccccaagaaacctcttgccgtcgtcgctgccaccaaaaaggctgtcgctgtc
ctcaaaggcacttccaatgttgaaggcattgtcactttgacccaagaagatgatggtccc
acaacagtggatgttcgtgtcacgggacttactccagggcctcatgggtttcacctacat
gagtatggtgacacaacgaatggatgcatttcaacaggagcacatttcaatcccaataac
atgacacatggggctcctgaggatgaagtccgtcacgcgggcgacctgggaaacatagtt
gctaatgctgatggggtggcagaagtaaaaattgtggacaaccagatactattgagtggt
cctaacacagtagttggaagagcatttgttgtgcacgagcttgaggatgaccttggaaaa
ggtggacatgaacttagtctaactactggcaatgcaggtggaaggttggcttgtggtgtt
gttggtctgactccaatataa

DBGET integrated database retrieval system