KEGG   Manihot esculenta (cassava): 110616950
Entry
110616950         CDS       T05761                                 

Definition
(RefSeq) cytochrome P450 86A1-like
  KO
K15401  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00071  Fatty acid degradation
mesc00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110616950
   00073 Cutin, suberine and wax biosynthesis
    110616950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mesc00199]
    110616950
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     110616950
Cytochrome P450 [BR:mesc00199]
 Cytochrome P450, plant type
  CYP86 family
   110616950
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110616950
NCBI-ProteinID: XP_021615183
LinkDB
Position
LG1
AA seq 511 aa
MEALPFFFTLAAATSAYLFWFYLLARKLSGPKLWPIVGSLPVLFKNRRQIHDWIASNLRA
TGGASTYQTCTIALPFLARRQGFYTVTCHPKNMEHILRTRFDNYPKGPHWQTAFHDLLGQ
GIFNSDGDTWLIQRKTAALEFTTRTLRQAMARWVNRTIKNRLWSILDKAASEKLAVDLQD
LLLRLTFDNICGLTFGKDPQTLSPEMPENPFAIAFDTATEATLQRLLYPGLLWRIEKMLG
IGSEKRLKKSLKVVENYMDDAVAARKENPSDDLLSRFMKKRDVDGNPFPISVLQRIALNF
VLAGRDTSSVALSWFFWLVMNHPEVEAKIVKEISTVLRETRGNDHQKWLEEPLDFDEADK
LVYVKAALAETLRLYPSVPQDFKYVVADDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGED
CMEFKPERWLSPEGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS
VVPGHRVQQKMSLTLFMKNGLRVFLQPRTLA
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggaagccttacctttcttcttcaccctagcagctgctacatctgcttatctcttttgg
ttctatctccttgctcgtaaactttctggtcctaagctatggcctatagtgggaagcctc
ccggttctgttcaagaacaggagacaaatccatgattggatcgccagtaatctcagagca
actggtggtgcatcaacttaccaaacgtgtactatagctcttcctttcctggctcgcagg
caaggtttctatactgtcacctgccatcccaagaacatggaacatatacttcgaacccgg
tttgataattatcccaagggtcctcactggcaaactgcgttccatgatctattgggtcaa
gggatctttaatagtgatggagatacatggctaatacagcgtaaaactgcggctttagag
ttcactaccaggactttgaggcaagccatggctcggtgggtgaaccggacgatcaagaat
cgcctgtggagcattttagataaagcagccagtgagaagctcgcagtggacttgcaagac
ttgctgcttcggttgacattcgacaacatttgtggactcacctttgggaaagatcctcaa
accctctctccagaaatgcctgaaaaccctttcgccattgcattcgatacagctactgaa
gctacccttcaacggcttctttatcctggtttgttatggagaattgagaagatgttagga
attgggtcagagaagagactaaagaagagcctcaaagttgtcgaaaattacatggacgac
gccgtagcagcacgcaaagaaaatccgtcggatgacttattatcgcgattcatgaaaaaa
agagacgtcgatggtaatccctttccaatctccgttctccaacgaatcgctctaaacttc
gtcctcgccggccgcgacacttcatcggttgctcttagctggttcttctggctagttatg
aaccacccagaagttgaagcaaagattgtcaaggaaatatcaactgtgctacgagaaacg
cgaggcaatgatcaccaaaaatggcttgaggagcctctagactttgatgaagccgataaa
ttggtctacgtgaaagcagcattagccgaaacacttcgtttatatccttcagtgcctcag
gatttcaaatatgtagtagcagatgatgttttaccggacggcacatttgtaccggcaggt
tcaaccgttacatattctatatattctgtagggagaatgaagagcatatggggtgaggat
tgcatggagttcaagccggagcgatggctgtcaccggaaggaaaccgatttgaacctcct
aaagatggctacaagtttgtggcctttaatgctggaccaaggacttgtttggggaaagac
ttagcctacctgcaaatgaagtctgtggcttcagctgtgctattgcgttaccgattatct
gtggtccccggccaccgtgtccagcagaagatgtctcttacgttgttcatgaagaatggg
cttcgtgtattcttgcaacctcgtacgctggcatag

DBGET integrated database retrieval system