KEGG   Manihot esculenta (cassava): 110617772Help
Entry
110617772         CDS       T05761                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00250  Alanine, aspartate and glutamate metabolism
mesc00410  beta-Alanine metabolism
mesc00430  Taurine and hypotaurine metabolism
mesc00650  Butanoate metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Module
mesc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110617772
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110617772
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110617772
   00430 Taurine and hypotaurine metabolism
    110617772
Enzymes [BR:mesc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110617772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 YjeF_N
Motif
Other DBs
NCBI-GeneID: 110617772
NCBI-ProteinID: XP_021616456
LinkDB All DBs
Position
LG6
AA seq 499 aa AA seqDB search
MVITTTIAADSDEFLYCTFASRYVRSPVPRFKMPEKSMPKEAAYQVINDELMLDGNPRLN
LASFVTTWMEPECNDLILASINKNYVDMDEYPVTTELQNRCVNMIAHLFHAPVGDDETAV
GVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELK
EVKLKEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNELLTKKNEETGWDI
PIHVDAASGGFVAPFVCPDLPWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRAKEDLPEE
LIFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKKVIENCMENTRVLKGGLE
KTGRFDIVSKDVGVPLVAFSLKDSSKYSVFDMSENLRRFGWIIPAYTIPADAEQIAVLRV
VVREDFSRSLAERLIWHIEQVLEEMDSLPIQMSTKAATVKKQLESTEGQKVVKKSEKEMQ
EEITRYWRRLVDGKRIGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcactaccaccattgctgcagactccgatgagtttctgtactgcacttttgct
tccagatatgttcgcagtcctgttccaaggtttaagatgccagagaagtcgatgccaaag
gaagcggcgtatcaggtgattaatgatgaactgatgttggatgggaatccaaggcttaac
ttggcttcttttgtcaccacttggatggagcctgagtgtaatgatctcatcttggcttct
attaacaagaactatgttgatatggatgagtaccctgttacaactgagctccagaatcgg
tgtgtgaatatgatagcccacctgttccatgctcctgttggagatgatgaaactgcagtt
ggggtggggactgtgggatcatcagaggcaattatgctggctggattagcttttaaaagg
aaatggcagaacaagagaaaagcagagggcaaaccatatgataagcccaacattgtgacg
ggagctaatgtgcaagtctgttgggagaaattcgcaaggtacttcgaagttgaactaaag
gaagtgaagctgaaagagggctattatgtgatggaccctgtgaaagcagttgaaatggtg
gatgagaacacaatctgtgttgcagccattttaggatcaacattgacgggagagtttgaa
gatgtgaagcttcttaatgaactactcactaaaaagaatgaggaaactggatgggacatc
ccaattcacgtcgatgctgccagtggaggttttgttgctccttttgtttgcccagatctt
ccgtgggatttccgtttgccattggtgaagagtattaatgtaagtggtcataagtatggc
cttgtttatcctggtgttggttgggttgtgtggagggctaaagaagacttgccggaggag
cttatttttcacattaactaccttggatctgatcaacccactttcactctcaacttctca
aaaggctctagtcaaataattgctcaatattatcagtttataaggcttggttttgagggt
tataagaaagttattgaaaactgtatggaaaatacaagggtgctgaaaggaggacttgag
aaaacagggaggtttgacattgtctccaaagatgttggagtgcctcttgtggccttctct
ctcaaagacagcagtaaatacagtgtgtttgatatgtctgagaacttgagaagatttggc
tggataattccggcgtacacaattccagcagatgccgagcaaattgctgttcttcgagtg
gtggtcagggaagatttcagccggagtctggctgaaagactcatctggcacattgagcaa
gttttggaggaaatggactcacttcctatccagatgtccaccaaagctgccactgttaag
aaacaactggagagcactgaagggcagaaggtagttaaaaagagtgagaaggagatgcag
gaagagatcactcggtattggaggcggcttgtagatggcaagagaattggagtgtgctag

DBGET integrated database retrieval system