KEGG   Manihot esculenta (cassava): 110618293Help
Entry
110618293         CDS       T05761                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase-like isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00040  Pentose and glucuronate interconversions
mesc00051  Fructose and mannose metabolism
mesc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110618293
   00051 Fructose and mannose metabolism
    110618293
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110618293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C TrkA_N Methyltransf_25 UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 110618293
NCBI-ProteinID: XP_021617138
LinkDB All DBs
Position
LG6
AA seq 364 aa AA seqDB search
MSSGGDIMAGKEREEEENMAAWLLGIKNLKIQPYHLPSLGPYDVKVRIKALGICGSDVHH
FKTMRCANFIVKKPMVLGHECAGVIEEVGSEVNTLAVGDHVALEPGISCRRCNLCKDGRY
NLCPEMKFFGSPPTNGALANKVVHPANLCFKLPENVTLEEGAMCEPLSVGVHACRRAKIG
PDTNVLIMGAGPIGLITLLTARAFGAPRVIIVDVDDQRLSIAKNLGADEILQVSTNIEDV
GEEAMKIQSAMGSGIDVSFDCVGYAKTMSTALNATRSGGKVCLIGLALSEMTVPLTPAAA
REVDIVGIFRYRNTWPLCIELLRTGKIDVKPLITHRFSFSQVEVEKAFETSAGGGNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtggtggtgatattatggcaggcaaagaaagagaagaagaagagaacatggct
gcttggctgcttggaatcaagaaccttaagattcagccttatcaccttccttctcttggt
ccctatgatgttaaagttcggataaaggctcttggtatctgtggaagtgatgttcatcac
ttcaagacaatgagatgcgcaaattttattgtcaaaaagccaatggtcttaggacatgaa
tgtgctggggtcatagaggaagttgggagtgaagtgaacactctagcagtgggagaccat
gtagcattggaacctggaatcagttgccggcgatgcaatctctgcaaagatggtcgctat
aatctatgtcctgaaatgaagttctttggatctccaccaactaatggtgctcttgccaat
aaggtagtgcatcctgcaaatctctgtttcaaactacctgaaaatgtgactctggaagaa
ggggcaatgtgtgaacccctcagtgttggagtccatgcttgtcgccgtgcaaaaattggt
ccagatacaaacgtcttgatcatgggagcaggaccaattggcctcatcaccttgttgact
gctcgtgcatttggtgctcctagagttattattgttgatgttgatgatcaacgtttatcc
attgcaaagaatcttggtgcagatgagatccttcaagtctcaacaaatattgaggatgtc
ggtgaagaagcaatgaagatacaaagtgctatgggctcaggaattgatgtgagttttgac
tgtgttgggtatgccaaaaccatgtctacagctctgaatgccacacgttcaggtggcaaa
gtttgccttattggattagccttgagtgagatgactgtccctcttactccagctgctgca
agggaggttgatattgttggcatatttcgatatagaaacacatggccactatgcattgaa
cttttgaggactggtaagattgatgttaagcccttgataactcacaggtttagcttctca
caagtggaggtagaaaaagcatttgaaactagtgcaggtggcggcaatgctattaaggtc
atgtttaacctttaa

DBGET integrated database retrieval system