KEGG   Manihot esculenta (cassava): 110621010Help
Entry
110621010         CDS       T05761                                 

Definition
(RefSeq) ribonuclease II, chloroplastic/mitochondrial isoform X1
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mesc03016]
    110621010
Enzymes [BR:mesc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     110621010
Transfer RNA biogenesis [BR:mesc03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    110621010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB PTPS S100PBPR
Motif
Other DBs
NCBI-GeneID: 110621010
NCBI-ProteinID: XP_021620693
LinkDB All DBs
Position
LG8
AA seq 794 aa AA seqDB search
MMALRAVNTCSLFRTASPPPLFALQYHFCHFKTLQYGRYIKFGFQSNIIRCDSFYCHGGS
IRSCSVHSLVNSVMEELAAIRKRKRVCSAIKLTSSGELLNDKLVNRVLEKGLLLEFKKDS
DRVLLAVAQRPDGKKNWMVYDQNGVMSSIKPQQVTYIVPGVENFDYTEISKFIQKAQDNL
DPSLLEFAWVELLEKNKSVTPEELAEMIFGSVEPLESYCAHLLLSKDEIYFTVLETRGSC
ALYGPRPATQVEELINRKLAREAAEKDLHEFLQLLKSAKAMPSHAKPSKSSWMIEEKIQE
KIESLEAYAIDACKSDGQKKTAGMILKAMGMAKAASSAVNLLIDIGYFPVHVNLDLLKLN
IATDHSDEVISAAENLVLASVDPDKTNRKDLTDLKVYAIDVDEADELDDALSATRLQDGR
IKVWIHVADPAQYVQPGSTMDRTAMRRGTSVFLPTATYPMFPEKLAMEGMSLKQGEVCNA
VSVSVVLHPDGCIAEYSVDNSIIKPTYMLTYESASELLHLNLEEEAELRLLSEAAARRLQ
WRRQQGAVDTTTLETRIKVANPEDPEPSINLYVENQADPAMRLVSEMMILCGEVIATYGS
CHNIPLPYRGQPQSNIDVSAFAHLPEGPVRSAAIVRIMRAAEFDFRKPIRHGILGIPGYV
QFTSPIRRYMDLLAHYQVKAFLRGESPPFSAGQLEGMASIVNMQARVARRLCNSSLRYWI
IEFLKRQPKERRYHALILRFIKDRVAALLLVEVGFQASAWVSVGRHIGDEIQVLVEEAHA
RDDILSLKEVIQGN
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcttcgagctgttaacacttgttctctctttcgcaccgcttctccacctcct
ctctttgcgcttcaataccatttttgccatttcaagaccttgcaatatggccgctacatc
aaatttgggtttcagtccaacataattcgctgcgactcattttattgtcatggcggcagt
atcaggagctgttcggtccacagtctcgtcaacagcgtcatggaagagcttgcagctatt
cgcaaacgcaagagagtttgctccgccatcaaattaaccagcagtggagagcttctgaat
gataagcttgtaaaccgggtgcttgagaaaggattgttgctggagttcaagaaggattcc
gatagagttctattggcagtggcacagaggccagatggaaagaagaattggatggtgtat
gatcagaatggtgttatgtcctccattaaaccacagcaagttacttatattgttccgggt
gttgaaaattttgactacacggagatctctaaatttattcagaaagctcaagataacttg
gacccatcactgctagagtttgcttgggttgaacttctagaaaagaataagtcagtaact
ccagaggaattagcagagatgatttttggtagtgtggaacctcttgagagctattgtgca
catcttttgctgtcaaaagatgaaatatatttcacagtgttggagacaaggggttcttgt
gctctttatggacctcggcctgctacacaggtggaagaactaatcaacaggaagcttgct
agggaggctgctgaaaaagatcttcatgagtttctccaattactaaaatctgctaaggca
atgccttcacatgctaaaccttccaaatcatcatggatgattgaagagaaaatccaagaa
aaaattgaatctcttgaagcatatgcaattgatgcatgcaaaagtgatggccaaaagaaa
acagcagggatgatcctcaaggcaatgggaatggcaaaagcagcatcctctgctgtaaac
ctcctcatagatattgggtatttccctgtccatgtcaatcttgatctattgaagttaaat
attgctacggatcattcagatgaggttatatcagctgctgaaaatcttgtgttggcatca
gttgacccagacaagaccaacagaaaagatcttactgacttaaaggtctacgccattgat
gttgatgaagctgatgagcttgatgatgccttgagtgcaacaaggttacaggatggtcgg
atcaaagtttggatacatgttgcggatccagctcaatatgtccaacctggaagcacaatg
gacaggacagcaatgagaagaggcacttctgttttcttgcccacagctacttatccaatg
tttccagagaagcttgctatggagggaatgagtttgaaacaaggagaggtttgcaatgct
gtttcagtatctgttgttctacaccctgatggctgcattgcagaatattcagtggataac
tcaatcattaaaccaacctatatgctgacatatgagagtgcatctgagttgcttcatttg
aaccttgaagaggaggctgaattaagacttctttctgaggctgcagctcgccggttacaa
tggcgccgccaacagggtgcggtcgacacaaccaccttggaaactcgtatcaaggtggct
aatcctgaagatccagagccttcaattaatctttatgttgaaaaccaagctgatcctgca
atgcgacttgtctctgagatgatgatactctgcggggaagtcatagccacctatggctct
tgccacaacattcctttaccctatagaggacaaccccaatcaaatattgatgtatctgct
tttgcacacctccctgaagggcctgttagaagtgctgcgattgttagaataatgcgcgca
gctgaatttgatttcagaaaacctatacggcatgggattttgggaatacctggttatgtt
caatttacttctcctattcgcagatatatggatcttcttgctcattatcaagtcaaagct
tttctaagaggtgaatctcctcctttctcagctggtcagctggaagggatggcatcaata
gttaacatgcaagctagagtagcaaggaggctctgtaacagcagtcttcgctattggata
attgaattcttgaaaaggcaaccaaaagagagaagatatcatgcactgatccttagattt
atcaaagatcgagttgcagccttactactagttgaggtgggatttcaagcgtctgcatgg
gtgtctgtaggaaggcatataggagatgaaatacaagttctggtagaagaagctcatgca
cgtgatgatattctttctctcaaggaggttatacagggcaactaa

DBGET integrated database retrieval system