KEGG   Manihot esculenta (cassava): 110625924Help
Entry
110625924         CDS       T05761                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc03030  DNA replication
mesc03410  Base excision repair
mesc03420  Nucleotide excision repair
mesc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110625924
   03410 Base excision repair
    110625924
   03420 Nucleotide excision repair
    110625924
   03430 Mismatch repair
    110625924
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mesc03032]
    110625924
   03400 DNA repair and recombination proteins [BR:mesc03400]
    110625924
Enzymes [BR:mesc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110625924
    6.5.1.6  DNA ligase (ATP or NAD+)
     110625924
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110625924
DNA replication proteins [BR:mesc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110625924
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110625924
DNA repair and recombination proteins [BR:mesc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110625924
   NER (nucleotide excision repair)
    Other NER factors
     110625924
   MMR (mismatch excision repair)
    Other MMR factors
     110625924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 110625924
NCBI-ProteinID: XP_021627315
LinkDB All DBs
Position
LG11
AA seq 804 aa AA seqDB search
MLTLRSCSSLRFIFLPHRSNFFSSFLFSFSSSKSPFLPNSPHLVVKFNPKSTMSSRPSAF
DTLMSNARAAAKKKPQSQSTSPKKRKNPAKTLNSVEAETTPNPTIPDSTHSQDETSKSTV
DHEIVTKSQISSSENPSLSMVKLGQERVINTKKQRVEIADLKSKIELLKKSPGDFDPKKV
LSWEKGERVPFIFVCLGFELIEKESGRILITNMVCNMLRTVMDTTPDDLLALVYLLANKI
APAHEGVELGIGESIIIKALAEAFGRTEKQVKKQLEGTGDLGLVAQASRSSQSMMRKPDP
LTVAKVFNTFRLIAKESGKDSQDKKKNHIKALLVAATDCEPLYLIRLLQGKLRISLAGQT
LLAALGQAAVFNENHSTPPSHINSPLEEAAKIVKQVYSVLPVYDKIVPALLSDGVWNLPK
SCSFTPGVPVGPMLAKSIKKVSEIADKFQNMEFTCEYKYDGERAQIHYLENGTVEIYSRN
AERNTGKYPDVIVTISRLKRKPVKSFVLDCEIVAYNREEKKILPFQILSTRPRKNVTMSD
IKVNVCIFAFDILYLNGEPLIQKELEVRRQRLYDSFEEEPGFFQFATAVTSNDLEEIQTF
LSAAVDASCEGLIIKTLKKDATYEPSKRSLNWLKLKKDYMDNIGDSLDLVPIGAFHGRGK
RTGVYGAFLLACYDFDNEEYQSICKIGTGFSEQLLEDLSNGLRSKVIPKPKPYFRHGDKI
NPDVWFEPSEVWEVKAADLTISPVYSAALGKAERDKGVSLRFPRLVKVRADKSPEQATTS
EQVAEMYNAQKPNQPKNQDDSEDD
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgctcactctccgttcatgctcttctctgcgattcattttccttcctcatcgctccaat
tttttctcttctttccttttctccttctcctcctctaaatctccctttcttcctaattct
cctcatctcgttgttaaattcaatcctaagtccacaatgtcctctcgcccctccgctttt
gacacactaatgtcaaatgcacgcgccgccgctaagaaaaaaccccagtctcaatccacc
tcacccaaaaagcgcaaaaaccctgctaaaaccctcaattccgttgaagcagaaactacc
ccgaatcccactatccctgactcaactcattctcaagatgaaacaagcaagtccacagtg
gaccatgaaattgtaactaaatcccaaatctctagctcggaaaaccctagtttatctatg
gttaaattgggtcaagaaagagttatcaataccaagaaacaacgtgttgaaattgcggac
ttgaagagtaagattgagttattaaagaagagcccgggggattttgaccccaaaaaggtg
ttgtcttgggagaagggtgagagggttccttttatatttgtttgtttggggtttgagttg
attgaaaaagagagcgggaggattttgatcactaatatggtgtgcaatatgttgagaact
gtaatggatacgacgcctgacgatttgctagcattggtatatcttttggctaacaagatt
gctcctgcgcatgaaggagtggagctgggaattggagaatcaatcattatcaaagcactt
gcagaggcgtttgggagaactgagaagcaagtcaagaagcaattagagggaacaggagat
ctaggccttgttgctcaagcaagccgctcatcgcaatccatgatgcgcaagcctgatcca
ttaacagttgccaaagttttcaatacatttcggctgattgccaaggaatctgggaaggat
agccaagataagaaaaagaatcatattaaggcacttcttgttgcagccactgactgtgaa
cctctatatttaattcgtctgcttcagggaaagctgcgaattagtttggcaggacagact
cttttggcagcactgggacaagctgctgtattcaatgaaaaccatagcactccaccttca
cacatcaattctcctttggaagaggctgcaaagattgttaaacaagtctactctgtactt
cctgtgtatgataaaatagttcctgctcttcttagtgatggtgtatggaatcttcccaag
tcttgtagctttactcctggtgtccccgtcggaccaatgcttgcaaagtcaataaaaaag
gtttctgagatagcagataagttccagaatatggaattcacctgtgaatacaagtatgat
ggtgaacgagcccagatacattacctggagaatggtacagtcgagatatacagtcgaaat
gctgagcggaatactggaaaatatcctgatgttattgttacgatttcaagattaaagagg
aagcctgtaaaatcatttgtcttggactgtgaaattgttgcttacaacagagaggaaaaa
aaaattctgccctttcagatccttagtactcggccacgcaaaaatgtcacaatgagtgac
atcaaggttaatgtttgcatatttgcatttgatatcttgtatcttaatggcgaacccctt
attcagaaagaactagaagttcgtagacagcggctttatgactcatttgaggaagaacct
ggattttttcagtttgcaacagcagtaacatcaaatgatcttgaggagattcaaactttc
cttagtgctgctgttgatgcaagttgtgagggtttaatcattaaaacattgaagaaagat
gctacatatgagccttccaagcgatcactgaattggttaaaattgaagaaagattacatg
gacaatattggagattcactggatctagtaccaattggggctttccatggtcgtgggaaa
cgtacaggtgtctatggtgcttttcttcttgcttgttacgactttgataacgaagagtac
caaagcatatgcaaaataggaactggattttctgagcaattgcttgaagatctatctaat
gggcttcgttctaaagtgattcctaagccaaagccatactttaggcatggagataaaatt
aatccagatgtgtggttcgagcctagtgaggtgtgggaggtgaaagctgcggacttgacc
attagccctgtttacagtgctgcacttggcaaagcagagagagacaagggtgtttcgctg
cgatttccacgactagtaaaagtccgggcagacaagtctccagagcaagccacaacatct
gagcaggttgctgagatgtataacgctcagaagcctaatcaaccaaaaaatcaggatgac
agtgaagatgattga

DBGET integrated database retrieval system