KEGG   Manihot esculenta (cassava): 110627337Help
Entry
110627337         CDS       T05761                                 

Definition
(RefSeq) S-adenosylmethionine carrier 1, chloroplastic/mitochondrial
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mesc02000]
    110627337
Transporters [BR:mesc02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   110627337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Gly-zipper_YMGG
Motif
Other DBs
NCBI-GeneID: 110627337
NCBI-ProteinID: XP_021629298
LinkDB All DBs
Position
LG12
AA seq 328 aa AA seqDB search
MGPFTLAIDAKGSSKVPSGFADAPIRKMQNSSHLKARKAFASMSVQEEKPFDFLRTLFEG
VIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIILKGLYSGLAGNLAGVLPASALFVGV
YEPTKQKLLRMFPENLSAVAHLTAGAIGGVAASLIRVPTEVVKQRMQTGQFTSAPDAVRL
IVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKAAARRELNDPENAIIGAFAG
ALTGAITTPLDVIKTRLMVQGSANRYKGIFDCVQTVVREEGPAALLKGIEPRVLWIGIGG
SIFFGVLESTKRYLVQRRPTPTQDQKQD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggtccttttacattagctattgatgcaaaaggctcttccaaggtgccttcaggtttt
gcagatgccccaattaggaaaatgcaaaactcttctcatctgaaagcaagaaaggctttt
gcatcaatgagcgtgcaagaagaaaaaccattcgattttttgcgtactttatttgaggga
gttatagcaggaggtacagctggtgttgtagttgaaacagcattatatccaattgacacg
ataaagacaaggcttcaggcagctcgtggtggtgggaaaataattctgaagggtctttac
tctggactggctggaaatcttgctggtgttttaccggcttctgcattatttgttggagta
tatgagcctacaaagcagaaattattgcgaatgtttcctgaaaatcttagtgctgtagct
catctaactgcaggtgccattggaggggttgctgcttctctaattcgtgttcccacagag
gttgttaagcaaagaatgcagactgggcaatttacctcagccccagatgctgtccgcctt
attgtctctaaggaaggttttaaggggctctatgcaggatatggatcatttctgttgcga
gatttgccatttgatgcaattcagttttgtatctatgaacaacttcggataggttataaa
gcagcggcacggcgagaattgaatgatccagaaaatgctatcattggtgcttttgcaggt
gcactgactggagctataactacaccacttgatgtgattaagacaaggttaatggttcag
ggttcagctaaccggtacaaagggatctttgattgtgttcaaactgttgttagagaagaa
ggacctgctgctcttctcaagggaatagagccaagagttctgtggataggcattggaggt
tcaatattttttggtgtattagaaagcacaaagcgttatctggttcagaggcgtcctacc
cctactcaagatcaaaaacaagattaa

DBGET integrated database retrieval system