KEGG   Manihot esculenta (cassava): 110627342Help
Entry
110627342         CDS       T05761                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00562  Inositol phosphate metabolism
mesc01100  Metabolic pathways
mesc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110627342
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110627342
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mesc01009]
    110627342
Enzymes [BR:mesc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110627342
    3.1.3.48  protein-tyrosine-phosphatase
     110627342
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110627342
Protein phosphatases and associated proteins [BR:mesc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110627342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 LIN37 ERbeta_N
Motif
Other DBs
NCBI-GeneID: 110627342
NCBI-ProteinID: XP_021629306
LinkDB All DBs
Position
LG12
AA seq 620 aa AA seqDB search
MDSESAGPHCKVSNNDSPAKDSNTDSPAKTSNGDPSANTATRHDGKDSESPASGIQSQAS
SLKLPQPTAPTTDSQTGAFGISKFARLTSGLGLNFPSMTPGANERSQGSPASEQAGVLES
FTKGLVDSSRSAVKAMQAKARQAVSQNKRRYQEGGFDLDMAYITENIIAMGFPAGDLSSG
LFGFFEGFYRNHMEEVINFFETNHKGKYKVYNLCSERLYDASRFEGKVACFPFDDHNCPP
LQLIALFCKSAYSWLKEDIENVVVVHCKAGMGRTGIMISSLLLFLKFFPTADEAIDYFNR
KRCLDGKALVLPSQIRYVKYFERTLTYFNGENQPGRRCMLRGFRLHKCPYWIRPSITISN
HSGVLFSTRKHPKTKDLMPEDFWISSPKKAIVIFALPGEPGLTELVGDFKIHFHDRQGEF
YCWLNTTMTENRKTLNASDFDGFEKRKLPSPGFQVDVVMIDYDGTSLPTRSKADSATRGS
DNATSTDYSLKPSGGAATSSKRVSENEDDVFSDSEGEETDSSKSRQATSPGVGSTQSSHT
SNITTEQMRSLTHGTEQMSLGSREPSLINASAGPTTDKNEKPSSGFETRDLDSVVVSDFR
AIAADASVFSFGDEEDYESD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggattctgaatctgctggacctcattgcaaagtttctaataatgattcccccgccaaa
gattctaatactgattccccagccaaaacttccaatggcgatccttctgcaaatactgcc
actaggcatgatggtaaagatagtgaatcacctgcttcaggcatacaatcccaagctagc
agtttgaaactgccacagccaacagcacctacaacagattcccagactggagcttttggg
atttctaaatttgctcgtctcactagtggcctaggattgaattttccttccatgactcca
ggagcgaatgagaggtctcaaggtagcccggcatctgaacaagctggtgttcttgaatct
ttcactaaaggcctggttgattcatctcgaagtgctgtgaaggctatgcaggccaaggca
cgtcaagctgtatctcaaaataaacgtagatatcaggagggagggtttgatttggacatg
gcttatatcactgaaaatataattgctatgggtttccctgctggtgatttaagctctggg
ctttttgggttctttgaggggttctatcgaaatcacatggaagaagtgatcaatttcttt
gagactaatcataagggaaaatacaaagtgtacaatctttgttcggagagattatatgat
gcttcaagattcgaggggaaggtagcgtgcttcccatttgatgaccataactgtccacct
cttcagctgatagcattattttgtaaaagtgcatattcatggttgaaagaggacatagaa
aatgtggtggtagtacactgtaaagctggtatgggcagaactggcataatgataagtagt
ctacttttgttcctgaagttcttcccaacggccgatgaagctatcgattacttcaacagg
aaaagatgtctggatgggaaggctctagttctcccaagtcagattaggtatgtcaaatac
tttgaacgtacattaacatacttcaatggagaaaatcaacctggacgaaggtgcatgctt
aggggatttcggcttcacaaatgcccttattggataaggccctctattaccatatcaaat
catagtggggtcctgttctcaacaagaaagcatccaaaaactaaggatttaatgccagaa
gatttctggattagttcaccaaagaaagcgatagtcatatttgctctaccaggagaacca
ggcctcacagagttggttggggacttcaaaatacattttcatgatcgccaaggagagttc
tactgttggttaaatacaacgatgacagagaatagaaagacactaaacgcatccgacttt
gatgggtttgaaaagagaaaactgccttcaccagggtttcaagttgatgttgtgatgata
gattatgatggtaccagtttgccaacaaggtctaaagctgattctgccactagaggatct
gataatgctacaagcacagattatagtctgaaaccaagtggtggagctgcaactagttcc
aaaagagtctccgaaaatgaagatgacgtattctcagatagtgagggagaagaaaccgat
tcttcgaaaagtaggcaggctactagccctggagttggatccactcaatctagtcacaca
tctaatatcacaacagagcaaatgaggagcttaacacatggaactgagcaaatgtcactc
gggagtcgagaaccttcccttattaatgcttcagcagggccaactactgacaagaatgag
aaaccttcctcaggctttgagactagagacctggattctgtagtggtgagtgactttagg
gcaattgctgctgatgcttcagttttcagttttggagatgaagaagattatgaaagcgac
tga

DBGET integrated database retrieval system