KEGG   Manihot esculenta (cassava): 110627529
Entry
110627529         CDS       T05761                                 

Definition
(RefSeq) ethylene-responsive transcription factor ERF027-like
Organism
mesc  Manihot esculenta (cassava)
SSDB
Motif
Pfam: AP2
Other DBs
NCBI-GeneID: 110627529
NCBI-ProteinID: XP_021629575
LinkDB
Position
LG1
AA seq 261 aa
MLTYLNLSQHFLFFLRSFSLQSPTPMADPNMPSNLPQINQTQPPLSSPFDPSSHPFQPLL
LSRSIPTITCESPSPKHPSQPSSSNPTAMAMATTSAAPKRHPLYRGIRSRSGKWVSEIRQ
PRKSTRIWLGTYPTPEMAAAAYDVAALALKGDDAVLNFPGSVGSYPVPLSSSSTDIRNAA
AAAATFKKAEMNQALAQLPTNDDTLNANFTSGEGFIDEEALFDMPNLLMDMAEGMLLSPP
RINSSDDSAGTPDGESLWSYY
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcttacctaccttaatctctctcaacattttcttttctttcttaggtctttttccctt
cagagccctacccctatggctgaccctaacatgccttccaatttgcctcaaataaaccaa
actcagccaccattatcatcaccctttgaccctagctctcacccatttcagccattacta
ctgtcacgctctatccctacaatcacatgtgaaagcccttctccaaaacacccttctcaa
ccctccagctctaatcctaccgccatggccatggccaccacttctgcggctcctaaaaga
caccctttgtaccgaggaatccgcagccggagtggtaaatgggtgtctgaaatccggcag
cctcgcaaaagtactcgtatttggcttggtacctacccaaccccagagatggcagctgct
gcctatgatgttgcggctttagccttaaaaggtgatgatgcagttctgaattttcctggt
tctgttggatcttatcctgttcctctttcatcgtcatcaactgatatacgtaatgcagct
gctgctgctgctacatttaaaaaggccgaaatgaatcaagcattagcccagctgcctaca
aatgatgatacccttaatgccaattttacatcaggtgaaggatttattgatgaggaggca
ctgtttgatatgccaaatttgctgatggacatggcagaaggaatgcttctttcgccgcca
agaataaactcctccgatgactctgcaggaactccggatggagagagtctgtggagctat
tattga

DBGET integrated database retrieval system