KEGG   Manihot esculenta (cassava): 110630203Help
Entry
110630203         CDS       T05761                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00010  Glycolysis / Gluconeogenesis
mesc00053  Ascorbate and aldarate metabolism
mesc00071  Fatty acid degradation
mesc00280  Valine, leucine and isoleucine degradation
mesc00310  Lysine degradation
mesc00330  Arginine and proline metabolism
mesc00340  Histidine metabolism
mesc00380  Tryptophan metabolism
mesc00410  beta-Alanine metabolism
mesc00561  Glycerolipid metabolism
mesc00620  Pyruvate metabolism
mesc00903  Limonene and pinene degradation
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110630203
   00053 Ascorbate and aldarate metabolism
    110630203
   00620 Pyruvate metabolism
    110630203
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110630203
   00561 Glycerolipid metabolism
    110630203
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110630203
   00310 Lysine degradation
    110630203
   00330 Arginine and proline metabolism
    110630203
   00340 Histidine metabolism
    110630203
   00380 Tryptophan metabolism
    110630203
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110630203
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110630203
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110630203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110630203
NCBI-ProteinID: XP_021633260
LinkDB All DBs
Position
LG13
AA seq 541 aa AA seqDB search
MAARRISGLLSRSFTSASASALFPGGRNSSLGRGLSRYNSTIAAATAAEEPIVPSVAVNY
TRLLINGQFVDAASGKTFPTYDPRTGEVIAHVAEGDIEDVNRAVYAARKAFDEGPWPKMT
AYERSRIMLRFADLLEKHNDEIATLETWDNGKPYEQAAKIEVPMVVRLFRYYAGWADKIH
GLVVPADGQHHVQILHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVIKTAEQTPLT
AIYAAKLLHEAGLPEGVLNVVSGFGPTAGAALANHMDVDKLAFTGSTDTGKIVLELAARS
NLKPVTLELGGKSPFIICEDADIDQAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVE
KAKARAVKRLVGDPFKGGIEQGPQVDLEQFEKILKYIRSGIESGATLETGGERFGTKGFY
IQPTVFSNVTEEMLIAKDEIFGPVQSILKFKDLDEVIHRANATRYGLAAGVFTQNIDTAN
MLTRALRAGTVWINCFDIFDAAIPFGGYKMSGIGREKGIYSLSNYLQVKAVVTPLKNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaggaggatatctgggttgctctctcgctccttcacttctgcttctgcttct
gctcttttcccaggagggaggaattctagccttggtagaggattaagcagatataatagt
accattgcagccgctactgcagctgaggagccaatagttccttctgtagctgtgaattat
actcgacttttaattaatgggcagttcgttgatgcagcctcagggaagacttttccaaca
tatgaccctaggactggggaagtgattgcccatgttgctgaaggtgatattgaagatgta
aatcgagcagtctatgctgctcgcaaagcatttgatgaaggaccatggccaaagatgact
gcttatgaaaggtcaaggattatgttacgctttgctgatttgcttgaaaagcataacgat
gaaattgcaacacttgagacttgggataatgggaaaccatatgagcaggctgctaaaatt
gaagtaccgatggttgtacgcctatttcgatactacgctggttgggcagataagattcat
ggtcttgtagttccagctgatgggcagcatcatgtgcaaatcttgcatgagcctattggt
gttgcaggtcagattattccatggaattttcctcttctcatgtttgcttggaaggtcgga
ccagcattagcatgtggcaacactgttgttataaagacagcagagcagacaccattaact
gctatttatgctgctaagctacttcatgaggctggacttccagaaggcgttctgaatgtg
gtttctggttttggtccaactgctggtgcagctcttgccaaccatatggatgtggataag
cttgctttcactggatcaactgatacaggaaaaattgttctcgagttagcggcaagaagc
aatctcaagccagtaactttagaacttggaggaaaatcccctttcatcatttgcgaggat
gctgatattgatcaggctgttgagctggctcactttgcattgttctttaatcagggccaa
tgttgctgtgcaggctctcgcacatatgtgcatgagcgtgtatatgatgaattcgtggag
aaagcaaaggcacgtgctgtaaaacgtcttgtcggtgatccattcaaggggggtattgaa
caaggcccacaggttgatttggaacaattcgagaagatactgaagtacataaggtctggt
attgaaagtggagctactcttgaaactggaggagagagatttggcaccaagggcttttat
atccagcccactgttttctcaaatgttacagaagaaatgctgatagcaaaagatgagata
tttggtccggttcagtccatcttaaagttcaaggatcttgatgaagttatacacagggca
aatgccactcgctacgggctggctgcaggggtgttcacacaaaacatagacactgccaac
atgctgacacgagcattacgagctggaactgtatggatcaattgctttgatatctttgat
gccgccattcctttcggaggatacaagatgagcggaattgggagggaaaaggggatttac
agtctcagcaattacttgcaagtgaaggctgtggttactcccttaaagaatccagcatgg
ttatag

DBGET integrated database retrieval system