KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_09660Help
Entry
EJ066_09660       CDS       T05904                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EJ066_09660
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mesm03400]
    EJ066_09660
Enzymes [BR:mesm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     EJ066_09660
DNA repair and recombination proteins [BR:mesm03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EJ066_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AZN97532
UniProt: A0A3Q8XUX2
LinkDB All DBs
Position
complement(1926318..1927010)
Genome map
AA seq 230 aa AA seqDB search
MIARMQINPAPHHAKVQARRWPKPDFPETTEGDNARSIPELSEVAKACRRCPLWRNATQT
VFGEGPDKAKVIFVGEQPGDQEDLAGKPFVGPAGKVLDAILDDAGVDRQKVYVTNAVKHF
KFEPRGKRRIHSKPNAGEVQACRWWLDKELDLIKPNLAVALGATAAQSLLGKAVPIMRMR
GEVIEREDGLRVFVTIHPSFILRIRDAKDKQAERERFLRDMKAVKTLMAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccaggatgcagataaatcccgcgccacaccatgccaaggtgcaggcaagacgc
tggccgaagcctgactttcctgagacgacggaaggcgacaacgcaagatctattcccgaa
ctcagtgaagtggcgaaagcctgccgccgctgcccgctttggcgcaatgcaacacagacc
gtgttcggcgaagggcctgacaaggccaaggtgatcttcgtcggtgaacagcctggcgac
caggaggatctggccggcaaacccttcgtcgggccggcgggcaaggtcttagacgcgatc
cttgacgacgccggcgtcgatcgccagaaagtctatgtcaccaacgcggtcaagcacttc
aagttcgagccgcgtggcaagcgtcgtatccactccaagccgaatgccggcgaggtgcag
gcctgccgctggtggctcgacaaggagctcgatctgatcaagcccaatctggcggtggcg
cttggagcgacggcggcacagtcgctgctcggcaaggccgtgccgatcatgagaatgcgc
ggcgaggtcatcgagcgcgaagacggtttgcgcgtgttcgtcaccatccacccgtccttc
atcctgcgcatacgcgacgcgaaagacaaacaggctgaacgcgagcggttcctgcgggac
atgaaggcggtgaagacgctgatggccgcttga

DBGET integrated database retrieval system