KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_16350Help
Entry
EJ066_16350       CDS       T05904                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00061  Fatty acid biosynthesis
mesm00780  Biotin metabolism
mesm01100  Metabolic pathways
mesm01130  Biosynthesis of antibiotics
mesm01212  Fatty acid metabolism
Module
mesm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EJ066_16350 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EJ066_16350 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    EJ066_16350 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mesm01004]
    EJ066_16350 (fabI)
Enzymes [BR:mesm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EJ066_16350 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     EJ066_16350 (fabI)
Lipid biosynthesis proteins [BR:mesm01004]
 Fatty acid synthase
  Component type
   EJ066_16350 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AZN98614
UniProt: A0A3Q8XYK6
LinkDB All DBs
Position
3403197..3404015
Genome map
AA seq 272 aa AA seqDB search
MAGGQGLMAGKRGLVLGVANNRSIAYGIAKACVDHGAEIALTYQGEAFKKRVEPLAAELN
AHIAGHCDVTDPATLDAVFDDIAKHWGKLDFLVHAIAFSDKDELTGRYVETTRDNFLRTM
DISVFSFTTIAKRAEALMTDGGSLLTLTYYGAEKVMPHYNVMGVAKAALEASVRYLAVDL
GAKKIRVNAISAGPIKTLAASGIGDFRYILKWNEYNSPLKQTVTQEEVGDSAVYFLSNLS
RGVTGEVHHVDSGYHVVGMKAVDAPDISTVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtggacagggccttatggccggcaagcgcgggcttgtccttggcgtcgcgaac
aacagatcgatcgcctatggcattgccaaggcctgcgtcgaccacggcgccgagatcgcg
ctgacctatcagggcgaggcgttcaagaagcgcgtcgagccgctggcggcggaactcaat
gcccatatcgccggccactgcgacgtgaccgatccggcaaccctcgatgcggttttcgac
gacatcgccaagcattggggcaagctcgattttctcgtccacgccatcgccttttccgac
aaggacgaactgacaggccgctatgtcgagacgacgcgcgacaatttcctgcgcaccatg
gacatttcggtgttttccttcaccaccatcgccaagcgcgccgaggcgctgatgaccgat
ggcggctcgctgctgacgctgacctattacggtgcggaaaaagtgatgccgcactacaac
gtcatgggcgtcgccaaggcggcgctcgaagccagcgtgcgctatctggccgtcgacctc
ggtgccaaaaagatccgcgtcaacgccatctccgccggtccgatcaagacgctggccgcc
tccggcatcggcgatttccgctacatattgaagtggaacgaatacaattcgccgctgaag
cagacagtgacgcaagaggaggtcggcgattcagccgtctatttcctgtccaacctctca
cgcggcgtcaccggcgaggtccaccatgtcgattccggctaccatgtcgtcggcatgaag
gcggtcgacgcgccggatatttcgacggtcaaggactag

DBGET integrated database retrieval system