KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_20485Help
Entry
EJ066_20485       CDS       T05904                                 

Definition
(GenBank) hypothetical protein
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpgC_C
Motif
Other DBs
NCBI-ProteinID: AZN99309
UniProt: A0A3Q8XXI5
LinkDB All DBs
Position
4270875..4272092
Genome map
AA seq 405 aa AA seqDB search
MTIPISQGRDTRIPDRSARVPDRDTRIDVFRALALLIIFVDHVPGTVFETLTYKNFGFSD
AAEAFVLISGMSVALAYGSKFQPGNRLLAALKLWRRTGVLYIAHIVTTMVVVAIFCAAAV
FAKRPEILTMINIGPLISNAPQALIGIVTLGHQLGYNNILPVYSVLLLMAPAFLLLVSYR
PLAALALSGVLWLVAGIYQIAPPNYPESGFWFLNPLSWQFLFTIGMAGMLHVRRGGTIPV
NRWLVGAAAIYVAGALVWVHSPLWGRVSWLDLPVVLTGFDKTFLSLPRLLHILAVSYLVV
AIPSVSNLFRTSRDHPLAILGKRSLPVFIAGTLIAMAAQVMKLINPGGFAYDSLLISAGI
AMQFALAYYLEWLSGIGGKSKPVRSEAPAVHASFGVGGMTASASL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaccataccgatttcgcagggacgggatacgcgtatcccggatcgcagcgcgcgtgtc
ccggatcgcgatacgcgtattgacgtgttccgcgctctcgctctgctgatcatatttgtc
gatcacgtgccgggcaccgttttcgaaaccttgacctacaagaatttcggcttttcggat
gccgcggaggccttcgtgctgatctcgggcatgtccgtcgcgctcgcctacggctcaaag
ttccagcccggaaaccggctcctggcggcactgaaattatggcgccgcaccggcgtgctc
tatatcgcccacatcgtcacgacgatggtggtggtggccatcttctgcgcggcggcggtg
ttcgcgaagcggccggagatactgacgatgatcaacatcgggccgttgatcagcaacgcc
ccgcaagctttgatcggcatcgtcacacttggccatcagctcggctacaacaacatcctg
ccggtctattcagtgctgctgctgatggcgccggccttcctgctcctcgtcagctacagg
cccctggcggcgctcgcactctccggagtcctgtggctggttgccgggatctaccagatc
gccccgccgaattatccggagtccggcttctggttcctcaatccgctgtcgtggcagttc
ctcttcaccatcggcatggcgggcatgctgcatgtcaggcgcggcggcaccattccggtc
aaccgctggctggtcggcgcggcggcaatctatgtcgccggagcgttggtctgggtgcac
agcccgctgtgggggcgggtgtcgtggctggatctgcccgtggtgctgaccggcttcgac
aaaacgttcctgtcgctgccgaggttgctgcacatcctggccgtgagctacctggtggtg
gccattccttctgtctcgaacctgttccgcaccagccgtgaccatccgctcgccatattg
ggcaagcgctcgctgccggttttcatcgccggcacgctgatcgccatggcggcgcaggtg
atgaagctgatcaacccgggcgggtttgcctatgacagcctgctgatatcagccggcatc
gccatgcagttcgcgctcgcctattatctcgaatggctgtcgggtattggcggcaagagc
aagccggtccgcagcgaggcgccggctgtccatgcgtccttcggtgtagggggcatgacg
gcaagtgccagcctgtag

DBGET integrated database retrieval system