KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_22845Help
Entry
EJ066_22845       CDS       T05904                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00564  Glycerophospholipid metabolism
mesm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EJ066_22845
Enzymes [BR:mesm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EJ066_22845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 STPPase_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AZN99733
UniProt: A0A3Q8XYH3
LinkDB All DBs
Position
4739279..4740808
Genome map
AA seq 509 aa AA seqDB search
MGASSPIHDIFVIGGGINGCGIARDAVGRGFSVFLAEMNDLASGTSSGSTKLIHGGLRYL
EFYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKL
LPATKTLDMARDPAGKPLKPLFRKAFEYSDGWVNDARLVALNARDAADRGATIRTRTKVI
GARREGELWKVRLEDVQTGDTEEVKARLLVNAAGPWVDQVLSSTVGLNDVHNVRLVQGSH
IVIGKKFDDPRAYFFQNKDGRIIFAIPYEEEFTLIGTTDQDYPGDPQDVKISDAEIDYLC
AAASEYFAQPVKRSDIVWTYSAVRPLYDDGASKAQEATRDYVLKTDGGEGTAPIVNAFGG
KITTYRRLAESMLEKIEGFLGKRGKPWTANAPLPGGDFPANGFDAEVAKLKTAYPFLDAR
LARRLTRLYGTRARMLLGLARSNADLGRNFGADLYEVEVRYLVQNEWATTAEDVLWRRTK
RGLHLGREQAAALDEFMRGISRRHVAAAE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcatcatccccgatccatgacatcttcgtcatcggtggcggaatcaacggttgc
ggcatcgcccgcgatgcggttgggcgcggcttctcggttttccttgcggaaatgaacgat
ctggccagcggaacctcctccggctcgaccaaattgatccatggcggcttgcgctatctc
gagttctacgagtttcgcctggtgcgcgaggcgctgatggagcgcgaggtcctctggaag
aacgcgccgcacatcatctggccgatgcgctttgtgctgccttacgccaagggcttgcgc
ccggcctggctgatcaggctcggccttttcctgtatgaccacattggcgggcgcaaattg
ctgccggcgaccaagacgctggacatggcaagggacccggccggcaaaccgttgaagccg
ttgtttcgaaaggccttcgaatattccgatggctgggtcaacgatgctcggctggtggcg
ttgaacgctcgcgacgccgccgatcgcggcgcaacgatccgaacccgcacgaaggtcatc
ggcgcacgccgtgagggcgagctttggaaggtcaggctggaggacgtgcagaccggcgac
accgaggaggtcaaggccaggcttttggtcaacgccgccggtccgtgggtcgatcaggtt
ctgtccagcacggtcggcttgaacgacgtgcacaatgtccggctagtacagggcagccat
atcgtcatcggcaagaagttcgacgacccgcgcgcttatttcttccagaacaaggatggc
cgcatcatctttgccatcccctacgaggaagagttcacgctgatcggcaccaccgaccag
gactatccgggcgatccccaggacgtgaagatcagtgacgccgagatcgactacctatgc
gcggcagcgagcgaatatttcgcgcagccggtcaagcgttcggacatcgtctggacttat
tcggccgtgcgcccgctctacgatgacggcgcttcgaaggcgcaggaagcgacccgcgat
tatgtgctgaagaccgacggcggggagggcacggcaccaatcgtcaacgcctttggcggc
aagatcaccacctaccgccggctggctgaatcgatgcttgaaaagatcgaaggttttctc
ggcaagcgcggcaagccatggacagcgaacgcgccgcttccgggcggcgatttcccggcg
aacggcttcgacgcggaagtggcaaaactgaaaacggcctatccgttcctcgatgcgcgt
ctggcgcgccgactgacccggctttacgggacgcgcgcaaggatgctgctgggccttgcc
agatcgaatgccgaccttggccgcaactttggcgccgatctctatgaggttgaggtgcgc
tacctcgttcagaatgaatgggccacgacggccgaagatgtattgtggcgccggaccaag
cgaggcctgcatctcggccgtgagcaggcggcagcactcgacgaattcatgcgcgggata
agccggcgccatgtcgcggctgccgaatag

DBGET integrated database retrieval system