KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_24690Help
Entry
EJ066_24690       CDS       T05904                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00970  Aminoacyl-tRNA biosynthesis
mesm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EJ066_24690 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mesm03029]
    EJ066_24690 (gatB)
Enzymes [BR:mesm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EJ066_24690 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EJ066_24690 (gatB)
Mitochondrial biogenesis [BR:mesm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EJ066_24690 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AZO00063
UniProt: A0A3S9BMQ6
LinkDB All DBs
Position
complement(5092074..5093573)
Genome map
AA seq 499 aa AA seqDB search
MTLIDTRTPDAKRLISGATGDWEIIIGLEVHAQVTSEAKLFSGASTAFGAAPNANVSLVD
AAMPGMLPVINEECVKQAIRTGLGLKAEINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGKVTVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS
KPDMRSADEAKAYVTKLRTIVRYLGTCDGNMDEGSLRADVNVSVRRPGGEFGTRCEIKNV
NSIRFIGQAIDYEARRQIAILEDGSKIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAYVDALAKDLPELPDDKKARLISSLGLSTYDASILVSEKAIADYFEKVAAGR
DGKLAANWVINDLLGALNKAGKDIENAPVSPDQLGAVIDLIKEGTISGKIAKDLFEIVWN
EGGDPRQLVESRGMKQVTDTGAIEKAVDEVISANPDKVEQARAKPTMAGWFVGQVMKATG
GKANPQAVNDLVKAKLGIE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgacacccgcacgcccgacgccaaacgcctgatatcaggcgccaccggc
gactgggaaatcatcatcggcctcgaagtccacgcgcaggtgacctcggaggcaaagctg
ttctccggcgcctcgacggctttcggtgccgcacccaacgccaatgtcagccttgtcgat
gcggcgatgccgggcatgctgccggtcatcaacgaggaatgcgtcaagcaggcgatccgc
accggcctcgggctgaaggccgagatcaaccacaagtcggtcttcgatcggaagaactac
ttttatcccgatctgccgcagggctatcagatctcgcagttcaagcagccgatcgtcggc
gagggcaaggtgaccgtctcggtcggcccggaccggcagggcgaattcgaggacatcgag
gtcggcatcgaacgcctgcatttggagcaggatgccggcaagtcgatgcacgaccagcat
ccgaccatgtcctatgtcgacctcaaccgttccggcgtggcgctgatggagatcgtctcc
aaacccgacatgcgctccgccgacgaagctaaggcctatgtcaccaagctgcgcaccatc
gtgcgctatctcggcacctgcgacggcaatatggacgaagggtcgctgcgcgccgacgtc
aacgtctcggtgcgcaggcccggtggcgaattcggcacgcgctgcgagatcaagaacgtc
aactcgatccgcttcatcggccaggccatcgactacgaggcgcgccggcagatcgccatt
ctggaggacggcagcaagatcgaccaggaaacgcggctgttcgaccccaacaagggcgag
acgcgctcgatgcgctccaaggaagaagcgcacgactaccgctatttcccggatccggat
ctcctgccgctggagttcgaccaggcctatgtcgacgcgctggcgaaggatctgcctgaa
ctgcccgacgacaagaaggcgcggctgatctcctcgctcggcctgtcgacctacgacgcc
tcgatcctggtgtcggaaaaggcgatcgccgactatttcgagaaggttgccgctggtcgc
gacggcaagctcgccgccaactgggtcattaacgatctgttgggcgctctgaacaaggcc
ggcaaggatattgaaaatgctccggtttcgcccgatcagcttggcgcggtcatcgacctg
atcaaggagggcaccatctccggcaagatcgccaaggatctgttcgagatcgtctggaac
gagggcggcgatccgcgccagctggtcgaaagccgcggcatgaagcaggtcaccgatacc
ggcgccatcgaaaaggcggtcgacgaggtgatatcagccaacccggacaaggtcgagcag
gcgcgcgccaagccgaccatggccggctggttcgtcggccaggtgatgaaggcgacgggc
ggcaaggccaacccgcaagcggtcaacgacctggtcaaggcaaagctcgggatcgaatag

DBGET integrated database retrieval system