KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_31120Help
Entry
EJ066_31120       CDS       T05904                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00330  Arginine and proline metabolism
mesm01100  Metabolic pathways
mesm01110  Biosynthesis of secondary metabolites
mesm01130  Biosynthesis of antibiotics
mesm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    EJ066_31120
Enzymes [BR:mesm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     EJ066_31120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AZO01180
UniProt: A0A3Q8Y0Y1
LinkDB All DBs
Position
6401618..6402433
Genome map
AA seq 271 aa AA seqDB search
MTIRLVLAGCGNMGYAMLAGWLKSGKLPPAAVFVVEPNADLRKRAEALGCSAAADAGGIP
ADAVPSLVVIAVKPQVIRDVTAAYKRLGDGRTTFLSIAAGTPVATFEAILGDRAPIVRCM
PNTPAAIGKGMMVVFSNRLVSDDTRRFVADLLSASGEVTDIDDEGLMDAVTAVSGSGPAY
VFHFIEALTVAAEKAGLPAKTARLLAMQTVHGAASLAAESGEEPGVLRQQVTSPNGTTAA
ALAVLMGEDRLTHLLTDAVEAARLRSIELGK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaggctcgttctcgccggttgcggcaatatgggctacgccatgctcgcgggc
tggctgaaatccggcaagcttccgccggcagcggttttcgtggtcgagcccaatgccgat
ttgcgcaagcgcgccgaagcgctgggctgcagtgccgccgcggacgccggcggcattccg
gcggatgcggtgccgtcgctcgtcgtcatcgccgtcaaaccgcaagtgatccgcgacgtg
accgctgcctacaagcgcctcggtgacggccgcaccaccttcctcagcatcgctgccgga
acgccggtcgccaccttcgaggccatcctgggcgaccgcgcgccgatcgtgcgctgcatg
cccaacacgccggcggccatcggcaagggcatgatggtggtgttttccaaccggctggtg
tccgacgacaccaggcgtttcgtcgccgacctgctttcggcgagcggcgaagtgaccgat
atcgatgacgagggcctgatggacgcggtgacggcggtgtccggctcgggaccggcttac
gtcttccacttcatcgaggcgctgaccgtggctgccgagaaggcaggattgccagccaaa
accgccaggctgctggccatgcagacggtccatggcgctgcctcgcttgccgccgaaagc
ggcgaggagccgggcgtgctgcgccagcaggtgaccagccccaacggcaccacggccgcc
gcccttgccgtgctgatgggcgaggaccggctgacgcatctgctcaccgacgctgtggaa
gcggcgcggctaaggtcgatcgaactggggaagtag

DBGET integrated database retrieval system