KEGG   Mesorhizobium sp. B7: BSQ44_00070Help
Entry
BSQ44_00070       CDS       T04603                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00020  Citrate cycle (TCA cycle)
meso00310  Lysine degradation
meso00380  Tryptophan metabolism
meso01100  Metabolic pathways
meso01110  Biosynthesis of secondary metabolites
meso01120  Microbial metabolism in diverse environments
meso01130  Biosynthesis of antibiotics
meso01200  Carbon metabolism
Module
meso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
meso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSQ44_00070
  09105 Amino acid metabolism
   00310 Lysine degradation
    BSQ44_00070
   00380 Tryptophan metabolism
    BSQ44_00070
Enzymes [BR:meso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BSQ44_00070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: APH69946
UniProt: A0A1L3SKM9
LinkDB All DBs
Position
11207..14194
Genome map
AA seq 995 aa AA seqDB search
MARQDQANDQFSLTSFLYGGNANYIEELYASWQDDASSVSEEWRDFFGGLKDDADLVRKN
ARGASWERPNWPLKANGDLVSALDGDWGAVEKHFDKRTREKAAANGKAVAEADVHQATRD
SVRAIMMIRAFRMRGHLHANLDPLGMAKPQEDYNELSPENYGFTEADYDRPIFLDNVLGL
EFATIRQMLDILKRTYCSTIGVEFMHISNPEEKAWIQERIEGPDKGIEFTENGKRAILQK
LIEAEGFEQFIDVKYKGTKRFGLDGSEALIPALEQIIKRGGSMGLKEIVLGMAHRGRLNV
LSQVMGKPHRAIFHEFKGGSFTPDDVEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHL
EIVNPVVMGKARAKQDQVFGRKREEVVPIEDRAKVLPLLLHGDAAFAGQGVVAECLGLSG
LRGHRVGGTLHFIINNQIGFTTNPRFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVYAAK
VATEFRMKFHKPVVIDMFCYRRYGHNEGDEPSFTQPLMYKKIRSHQSAVQIYGKRLIESK
LITEEELEKMRAGWRAHLEAEFEAGQAYKPNKADWLDGAWSGLRSADNQDEQRRGKTAVP
MKTLKEIGKKLTETPKDFQAHRTIARFLENRRQAIESGEGIDWSTAEALAFGAILLEGNP
VRLSGQDSERGTFSQRHSVLYDQQDENRYIPLNNLGPQQANYEVINSMLSEEAVLGFEYG
YSLAEPRALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHS
SARLERFLQMCAEDNMQVANITTPANYFHSLRRQLKRDFRKPLILMTPKSLLRHKRAVST
LSEMSGESSFHRLLWDDAQMLPDQAIKLVKDSKIRRVVMCSGKVYYDLYEEREKRGMDDI
YLLRVEQLYPFPAKALITELSRFRNAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDAKHQ
RVRYTGRPAAASPATGLMSKHLAQLESFLEDALGE
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaggatcaggccaacgaccagttttccctcacctcgttcctctatggcgga
aacgccaactatatcgaagaactctacgcatcctggcaggacgacgcctcgtcggtctcc
gaggaatggcgcgatttcttcggcggactgaaggacgacgcggacctcgtccgcaagaac
gcccgcggcgcctcgtgggagcgccccaactggccgctgaaggcgaacggcgacctggta
tcggcgctggacggagattggggcgcggtcgaaaagcatttcgacaagcgcactcgcgag
aaggccgccgccaatggcaaggccgtcgcagaggcggacgtccaccaggccacgcgcgat
tccgtgcgcgccatcatgatgatccgcgccttccgcatgcgcgggcacctgcacgccaat
ctcgatcctctcggcatggccaagccgcaggaggattacaacgagctctcgccggagaac
tacggcttcaccgaggccgactacgaccgcccgatcttcctcgacaatgtgctggggctc
gagttcgccaccatccggcagatgctcgacatcctgaagcggacctattgctcgaccatc
ggcgtcgaattcatgcacatctccaatcccgaggagaaggcctggatccaggagcgcatc
gagggaccggacaagggcatcgagttcaccgagaacggcaagcgcgccatcctccagaag
ctgatcgaggccgagggtttcgagcagttcatcgatgtcaagtacaagggcacgaagcgc
ttcggcctcgacggcagcgaggcgctcatccccgcgctcgagcagatcatcaagcgcggt
ggttcgatggggctgaaggagatcgtgctcggcatggcacaccgcggccgcctcaacgtg
ctgtcgcaggtgatgggcaagccgcaccgggcgatcttccacgagttcaagggcggttcc
ttcacgccggacgacgtggagggctcgggcgacgtcaagtaccatctcggcgcctcctcc
gaccgcgagttcgacggcaacaaggtgcacctttcgctgacggccaacccctcgcacctc
gagatcgtcaatccggtcgtcatgggcaaggcgcgcgccaagcaggaccaggtgttcggg
cgcaagcgcgaggaggtcgtcccgatcgaggatcgcgccaaggtgctgccgctgctgctg
cacggcgacgccgccttcgcgggccagggcgtcgtggcggaatgcctcgggctgtcgggc
ctgcgcggccatcgtgtcggcggcacgctgcacttcatcatcaacaaccagatcggcttc
accaccaatccgcgcttctcgcgctcctcgccatacccctccgacgtggcgaagatgatc
gaggcgccgatctttcacgtgaacggcgacgacccggaagcggtcgtctacgcggccaag
gtcgcgaccgaatttcgcatgaagttccacaagccggtggtcatcgacatgttctgctac
cggcggtacggccacaacgagggcgacgaaccctcgttcacgcagccgctgatgtacaag
aagatccgctcgcaccagtccgctgtccagatctacggaaagcggctgatcgaatcgaag
ctgatcaccgaggaggaactcgagaagatgcgggccggctggcgcgcccatctggaagcc
gagttcgaagctggtcaggcctacaagcccaacaaggcggactggctggacggtgcgtgg
tctggtctgcgcagcgccgacaatcaggacgagcagcggcgcggcaagacggccgtgccc
atgaagacgctcaaggagatcggcaagaagctgacggaaacgccgaaggatttccaggcg
cacaggacgatcgcccgcttcctggagaaccgccggcaggcgatcgaatccggcgaaggc
atagactggtcgacggccgaggcgctggccttcggcgcgatccttctcgaaggcaacccg
gtgcgactctccggacaggattccgagcgcggcaccttctcgcagcggcattcggtgctc
tacgaccagcaagacgagaaccgctacatcccgctcaacaatctcggaccgcagcaggcg
aactacgaggtcatcaactcgatgctctcggaggaggccgtgctgggcttcgaatacggc
tattcgctcgccgagccgcgggcgctgaccttgtgggaagcgcaattcggcgacttcgcc
aatggcgcccaggtggtgttcgaccagttcatctcgtcgggcgagcgcaagtggctgcgc
atgtcgggtctagtctgccttttgccgcacggctacgaggggcagggaccggagcattcg
tcggcacggctggagcgcttcctgcagatgtgcgcggaagacaacatgcaggtggcgaac
atcaccacccccgccaattacttccacagcctgcgccgccagctgaagcgggatttccgc
aagccgctgatactgatgacgccgaagtcgctgctgcgccacaagcgcgcggtttcgacg
ctgtcggagatgtcgggcgaaagttccttccacaggctcctgtgggatgacgcgcagatg
ctgcccgaccaggccatcaagctggtgaaggactccaagatccgccgcgtcgtcatgtgc
tcgggcaaggtctattacgacctctacgaagagcgcgagaagcgcggcatggacgacatc
tacctcctgcgcgtcgaacagctctaccccttcccggccaaggcgttgatcacggagctg
tcgcgcttccgcaacgccgagatggtatggtgccaggaagagcccaagaacatgggtgcc
tggtcgttcatcgatccctacctggaatgggtgctggcgcacatcgatgccaagcaccag
cgcgtacgatacaccggccggcccgcggcggcttcgcccgcaaccggcctcatgtccaag
cacctggcgcagctcgagtccttcctcgaggacgcgctcggcgaatag

DBGET integrated database retrieval system