KEGG   Mesorhizobium sp. B7: BSQ44_02815Help
Entry
BSQ44_02815       CDS       T04603                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:meso00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BSQ44_02815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:meso03400]
    BSQ44_02815
Enzymes [BR:meso01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSQ44_02815
DNA repair and recombination proteins [BR:meso03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BSQ44_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: APH70429
UniProt: A0A1L3SLZ4
LinkDB All DBs
Position
complement(556768..559353)
Genome map
AA seq 861 aa AA seqDB search
MALETYNQKRNFERTSEPKGAAKASKGGNSFVIQKHDATRLHYDFRLEMNGVLVSWAVTR
GPSLVPGEKRLAVQTEDHPLEYGEFEGTIPKGEYGGGTVLLWDRGTWSPTGDLKKGLAKG
HLEFELSGEKLHGRWHLVRMARRGREKRDNWLLIKSDDEFAREEDDPDILEEAPKSVKTG
RDIPEIAEEAPGWSSKSGKLDKKTGKPAAKANTDGKAAAKAKPATSKKEAAEKPAAEDFP
KGSRKAKRPDFVEPQLATLRPEAPAGTRWIHEIKFDGYRLQAQLADGKVRLLTRSGLDWT
EKFGTAVADAFTGLPASEAVIDGELVVEGGGGASDFSALQADLSEGRSDRFVFYAFDLIY
LDGHDLRGAALIDRKERLAKLIANAPQSLRYSDHFEEDGEMILRHACRLSLEGVISKLRD
GKYRSGRGRDWIKSKCSDRQEFVIAGYVPSTTSDTAIGSLVLGHYEGDKLVHAGRVGTGF
SRKVAEDLFRKLDAIRRDRSPFDAPLDAASKRGVKFVEPRLVAEVEFRAWTADGILRHAS
FRGLREDKPPAEIVREQKAASKEKLPRWTVKLTHPDRIYWKDAGVTKEGLAEYYSQAWRF
MAPLVVNRPLALLRCPNGYDGQSFFQKHAWKGMSSNILTVHDPKDKSGQPIVAIDGFDGL
IGLAQGGVLEIHPWQASLHDLERPDQIVMDLDPGDGVEWQAVIEAANEVRERMEAEGFAC
FLKTSGGKGLHVVSPVKPSVGWDELKAFAKGIADSMAGDSPDRFVATVTKSKRRGKILID
YLRNGRGATAVAPYSTRARAGAPVSMPIAWDELSGEIGPAYFTVPNAPARLANLETDPWA
DFRKAEVPLGKSPKRKGKKAA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgagacatacaatcagaagcgcaacttcgaacggacttccgaaccgaagggt
gccgcgaaggcatcgaagggcggcaacagcttcgtgatccagaagcacgacgccacgcgg
ctgcactacgatttccggctggaaatgaacggcgtgctggtgagctgggccgtgacgcgg
ggtccgagcctcgtgccgggcgaaaagcgtctcgccgtacagaccgaggaccatccgctc
gaatacggcgagttcgaggggacgattccgaagggcgaatatggcggcggcaccgtgctg
ctgtgggaccgcggcacgtggagcccgaccggcgacctgaagaagggcctcgccaagggg
catctcgaattcgaactttcgggcgagaagctgcacgggcgctggcacctggtgcggatg
gcaaggcgcgggcgcgaaaagcgcgacaactggctgctgatcaaaagcgacgatgaattc
gcccgcgaggaggacgatcccgacatcctggaagaggcgccgaaatcggtgaagaccggc
cgcgacattcccgaaatcgccgaggaagcgccgggctggtcgtccaaatccggaaagctc
gacaagaagactggcaagccggcggcgaaggcgaataccgacgggaaggcggccgcaaag
gcgaagccggctaccagcaagaaggaagcggccgaaaagcccgccgcggaggatttcccg
aaaggcagccgcaaggcgaagcggccggatttcgtcgaaccgcaactcgcgacgctgcgg
cccgaggcgccggccgggacgcgctggatccacgagatcaagttcgacggctatcgcctg
caggcgcagctcgccgacggcaaggtcaggctgctgacgcgcagcggcctggactggacc
gagaagttcggtaccgcggtggcggatgctttcacgggcctgccggcgtcggaggccgtc
atcgacggggaactcgtggtggaaggcggcggcggcgcttcggatttttccgcgctccag
gccgacctgtcggaaggccgctccgaccgcttcgtgttttatgccttcgacctcatctac
ctcgacggacatgacctgcgcggggccgcgctgatcgaccgcaaggagaggctggcgaag
ctgatcgccaacgcgccgcagagcctgcgctacagcgaccacttcgaggaggacggcgag
atgatcctgcgccacgcctgccggctcagcctggaaggcgtgatctcgaaacttcgcgac
ggaaaataccgctccggccgcggccgggactggatcaagtcgaaatgctcggaccgacag
gaattcgtgatcgcgggctacgtgccgtcgacaacgtccgacaccgcgatcggctcgctg
gtgctcgggcattacgagggcgacaagctcgtgcatgcggggcgcgtcggcacgggcttc
tcgcgcaaggtggccgaagacctattccgcaagctggacgcgatccggcgggacaggtca
ccgttcgatgcgcctctcgacgcggcgtccaagcggggcgtgaagttcgtcgagccgcgg
ctcgtcgcggaggtcgagttccgggcctggaccgccgacggcattttgcgccatgcctcg
ttccgcggcctgcgcgaggacaagccgccggcggagatcgtgcgcgaacagaaggcggct
tccaaggaaaagctgccgcgctggacggtgaagctcacgcatcccgaccgcatctactgg
aaggatgccggcgtgacgaaggaagggctggcggaatattacagccaggcctggcggttc
atggcgccgctggtggtcaaccggccgctggcgctgctgcgctgcccgaacggctatgac
gggcagagcttcttccagaagcatgcctggaaggggatgagttcgaacatcctcaccgtc
cacgacccgaaggacaagtccggccagccgatcgtggcgatcgacgggttcgacgggctg
atcgggctagcgcagggcggcgtgctcgaaatccatccgtggcaggcctcgctgcatgac
ctcgaacgccccgaccagatcgtcatggatctcgatccgggcgacggcgtggaatggcag
gcggtgatcgaggcggcgaacgaggtgcgggagcgcatggaggcggaaggatttgcgtgc
ttccttaagacgtcgggaggcaagggcctgcacgtggtgagccccgtcaagccctccgtc
ggatgggacgagctgaaggcgttcgcgaaggggatcgccgattccatggcgggcgacagc
ccggaccgcttcgtggccaccgtgaccaagtcgaagcggcgcggcaagatcctgatcgac
tacctgcgcaacgggcggggagcgaccgcggtggcgccctactccacccgcgcacgcgcc
ggcgcgccggtgtcgatgccgatcgcctgggatgaactttccggagagatcgggccggcc
tacttcaccgtgcccaacgcgccggcgcggctcgccaacctggagaccgatccgtgggcg
gatttccggaaggcggaagtgccactcggcaagagcccgaagcgcaagggcaagaaagcg
gcctga

DBGET integrated database retrieval system